Reviews & Opinions
Independent and trusted. Read before buy Gateway 450ROG!

Gateway 450ROG

 

 

Gateway 450ROGGateway 450ROG Laptop Battery
14.1" LCD No hard drive or caddy. No AC adapter. No Battery Includes: Pentium M 1.4Ghz FSB 400Mhz 512KB L2 1GB Ram Wifi XP Home COA on Case screws missing from case & other cosmetic issues(see pics)

Details
Brand: Gateway
Part Number: 450ROG
UPC: 827103029741


Here you can find all about Gateway 450ROG, for example drivers and network service manual, memory, ram, laptop, battery, manual, specs. You can also write a review.
[ Report abuse or wrong photo | Share your Gateway 450ROG photo ]

Manual

Preview of first few manual pages (at low quality). Check before download. Click to enlarge.
Manual - 1 page  Manual - 2 page  Manual - 3 page 

Download (English)
Gateway 450ROG Laptop & Notebook, size: 851 KB
Related manuals
Gateway 450ROG Install Guide

Gateway 450ROG

 

 

Video review

Gateway 450ROG

 

User reviews and opinions

<== Click here to post a new opinion, comment, review, etc.

No opinions have been provided. Be the first and add a new opinion/review.

 

Documents

doc0

SPECIFICATIONS

Gateway 450ROG Notebook

Specifications are subject to change without notice or obligation. Processor and Core Logic
Processor options One Intel Pentium M CPU To determine your notebooks processor speed, click Start, My Computer, then click View System Information. The processor speed is listed. Processor packaging Level 2 cache Core logic Processor side bus speed Intel socketable micro-FCPGAMB with Advanced Transfer Cache Architecture Intel 855PM chipset
400 MHz front side bus -OR800 MHz front side bus Phoenix BIOS 512 KB Flash ROM SMBIOS 2.3 support Advanced Configuration and Power Interface 1.0b (ACPI 1.0b) support Advanced Power Management 1.2 (APM 1.2) Wired for Management 2.0 (WfM 2.0)

System memory

Memory type Memory expansion options 266 MHz DDR-SDRAM Two 200-pin industrial standard DDR-SODIMM sockets Accepts two PC-2100 SDRAM memory modules 1 GB maximum system memory No on-board memory To determine your notebooks memory, click Start, My Computer, then click View System Information. The memory is listed.

www.gateway.com

Graphics controller
ATI M7 or ATI M9 2D hardware acceleration 3D rendering acceleration
Video memory LCD display panel
32 MB or 64 MB 14.1-inch or 15.0-inch active matrix (TFT) LCD color display Maximum panel resolution: 14.1-inch: 15.0-inch: 1400 1050
Maximum color depth: 32-bit (16.7 million colors) LCD supported video modes 14.1-inch: XGA 15.0-inch: SXGA+ LCD maximum refresh rate Controls 60 Hz
Brightness level selectable through FN keys (up, down) Icon to display 8 levels of brightness Auto dim on battery Auto bright on AC power Supports dual display and extended desktop Integrated TV encoder
External video External CRT resolutions
Supports standard IBM VGA compatible modes Maximum resolution: 32-bit colors
External CRT maximum refresh rate TV out (composite video) jack TV out (S-Video) jack IEEE 1394
200 Hz Supports NTSC/PAL connection to standard TV monitors with RCA jack Supports NTSC/PAL connection to standard TV monitors with S-Video jack on optional port replicator
One 4-pin connector 100/200/400mps Supports video and audio capture Software included for motion and still-frame capture
Audio chipset Sound support Sigmatel Soft Audio AC97 rev 2.3 codec (STAC9752) PCI interface audio Multi-stream Direct Sound and Direct Sound 3D acceleration SoundBlaster Pro, MIDI, Windows Sound System compatible, MP3, WMA S/PDIF output for PCM or AC-3 content via Toslink jack on optional port replicator PCI Power Management Interface (PPMI) 1.1 compliant NOTE: This notebook does not have an internal microphone.

Digital DVD audio

Provides full 5.1 channel Dolby Digital output (AC-3) from DVD decoder through Toslink optical S/PDIF jack on optional port replicator.
Volume controls Internal speakers Audio jacks
Volume control keys on keyboard Software control provided through Windows Stereo speakers built into front of notebook 1.5 W maximum output Stereo headphone output Stereo line input Monophonic microphone input

Communications

Modem features
Integrated V.92/56K data/fax modem Uses the RJ-11 jack on the back of the notebook Supports Wake on Ring from S3 power mode Integrated 1000BASE-T, 100BASE-TX, and 10BASE-T (802.3, 802.3u, and 802.3ab) Ethernet interface Uses the RJ-45 jack on the back of the notebook Supports Wake on LAN from S3 power mode

10/100/1000 Mbps Ethernet interface features
Wireless Ethernet interface features (Factory installed option)
Intel PRO/Wireless IEEE 802.11b network card embedded in the notebook -ORIntel PRO/Wireless IEEE 802.11b/g network card embedded in the notebook -ORBroadcom BCM94306 IEEE802.11g network card embedded in the notebook -OR-
Broadcom BCM94300 IEEE802.11a/g network card embedded in the notebook Antenna: Uses factory-installed internal antenna assembly
Operating channels: 11 selectable channels Security: 128 and 64 bit WEP encryption Operating Frequency 2.4 GHz Direct Sequence Spread Spectrum (IEEE 802.11b and IEEE 802.11g) 5.0 GHz (IEEE 802.11a) Maximum Data Rate
54 Mbps (IEEE802.11g and IEEE 802.11a) 11 Mbps (IEEE802.11b)

Input/Output (I/O)

Keyboard
U.S. English keyboard Full-sized 86-keys 19 mm 19 mm key pitch 3.0 mm keystroke Gateway EZ-Pad touchpad 4-button design
Pointing device Multifunction buttons LED status indicators
Four hot keys that launch e-mail, Web browser, help application, and My Computer
Caps lock PAD lock Scroll lock Hard drive access Module bay access/bay swap Power/Suspend Battery status

Input/Output (I/O) ports


Two USB 2.0 (4-pin) High-speed serial Parallel (bi-directional, EPP, ECP) IEEE 1394 (4-pin) V.92, 56K Modem (RJ-11) 10/100 Ethernet (RJ-45) External monitor (VGA) TV out (NTSC/PAL composite video) Stereo headphone output Stereo line input Monophonic microphone input PS/2 keyboard or mouse PC Card sockets (two Type II or one Type III) Docking port DC input

PCMCIA

Accepts two Type II or one Type III device Ricoh R5C554 controller NOTE: This notebook does not support Zoom Video.

Docking solution

Type Docking supported Port replicator
Hot dock Warm dock Cold dock Two USB 2.0 (4-pin) High-speed serial Parallel Modem (RJ-11) Ethernet (RJ-45) External monitor (VGA) S-Video TV out S/PDIF digital audio out Stereo headphone output Analog audio line input (stereo) Two PS/2 Docking port DC input

Input/Output (I/O ports)

Security

Kensington lock loop

Storage

Hard drive controller Hard drive Supports up to Ultra DMA 100 and up to PIO mode 4 User removable 2.5-inch diameter 9.5 mm height To find the hard drive capacity, click Start, then click My Computer. Right-click the drive letter, then click Properties. The drives capacity and available space appear. If the drive has multiple partitions (for example, C: and D:), add the capacities of each partition to determine the drives total capacity.

Super I/O controller

NS PC87391 LPC super I/O controller Diskette drive controller IEEE 1284 compliant parallel port Serial port

Modular bay

One modular bay is available on the notebook. The modules are hot-swappable. Optical Drive Available optical drives include: CD DVD Combination DVD/CD-RW DVD-RW/CD-RW To determine the type of drive in a bay, examine the drive trays plastic cover. A CD Compact Disc logo indicates a CD drive, a DVD logo indicates a DVD drive, a DVD logo in combination with a CD-R/RW logo indicates a DVD drive that also is a recordable/rewritable CD drive, and a DVD-ROM/R/RW logo in combination with a CD-R/RW logo indicates a recordable/rewritable DVD drive that also is a recordable/rewritable CD drive.
Second Hard Drive 2.5-inch diameter 12.7 mm or 9.5 mm high Diskette Drive
12.7 mm high 3.5-inch diskettes 720K/1.2M/1.44M support Memory Card Reader
Supports the following card types: CompactFlash IBM Microdrive Memory Stick MultiMediaCard Secure Digital SmartMedia Secondary Battery
Removable six-cell prismatic Lithium Ion battery pack 3.4 Ah 11.1 V nominal 37.74 Wh
Intelligent charger AC adapter Supports dynamic charge current to achieve the best charge performance
19 VDC, 4.2A, 80 W output -OR19 VDC, 4.74A, 90 W output Automatically adjusts for 100 to 240 VAC, 50 to 60 Hz power source Three-wire design Includes power LED

Battery type

Main Removable eight or six-cell Lithium Ion battery pack Embedded controller inside to support smart battery Secondary
Removable six-cell prismatic Lithium Ion battery pack

Battery capacity

Main 8-cell: 4.2 Ah 14.8 V nominal 62.16 Wh 6-cell:
3.8 Ah 11.1 V nominal 42.18 Wh Secondary
3.4 Ah 11.1 V nominal 37.74 Wh Battery life varies depending on configuration, programs, power management settings, and features used. Recharge time varies, depending on usage.

Power management

Advanced Configuration and Power Interface 1.0b or later (ACPI 1.0b or later) support SMBIOS 2.3 PC 2001 compliant CPU supports Intel Speedstep technology Keyboard-activated pop-up display gives battery charge as a percentage remaining Icon on taskbar shows battery charge as a percentage remaining Battery meter on battery

Controls

Power switch
Supports Power On/Off, Standby/Resume, Hibernate, Shutdown

Reset hole Lid switch

Resets whole system if notebook cannot be recovered by power switch LCD On/Off, Standby, Hibernate

Passwords Physical

Power-on password (2-level password support) Hard drive password Main system memory compartment screw Hard drive kit screw Mini PCI bay security screw Kensington security slot on notebook right side Kensington security ring on port replicator

System software

Operating system System management

Microsoft Windows XP Professional Microsoft Windows XP Home Edition SMBIOS 2.3 BIOS support Advanced Configuration and Power Interface (ACPI) power management Support for Wake on LAN from S3 power mode Support for Intel LANDesk Client manager 6.0 Wired for Management 2.0 (WfM 2.0) enabled PC2001 specification Advanced Power Management 1.2 (APM1.2) Advanced Configuration and Power Interface 1.0b (ACPI 1.0b) or later SMBIOS 2.3 Windows Hardware Quality Labs (WHQL) certified

System compatibility

Quick boot

Supported

Physical specifications
Dimensions 15.0-inch display ~13.15 10.63 1.3 in. (W D H) ~33 mm (W D H) 14.1-inch display ~13.15 10.63 1.21 in. (W D H) ~30.7 mm (W D H)

System weight

15.0-inch display (includes DVD drive and 6-cell battery) ~6.11 lbs. ~2.77 kg 14.1-inch display (includes DVD drive and 6-cell battery) ~5.64 lbs. ~2.56 kg Weight varies depending on configuration.

AC adapter weight

13 ounces (370 g)

Environment

Operating temperature Storage temperature Operating humidity Storage humidity Operating altitude, maximum Storage altitude, maximum 41F to 95F (5C to 35C) -4F to 140F (-20C to 60C) 20% to 80% relative humidity; no condensation 10% to 90% relative humidity; no condensation 8,000 feet at 59F (2,438 meters at 15C) 12,000 feet (3,658 m)
MAN SYS 450 ROG SPEC R6 6/04

doc1

Dpgfifpf

9tyqxftyytyrvpgfippiTtyrspvpgfiwy frp
Status indicators Power button Multi-function buttons
Keyboard Optional EZ Point pointing device
Optional EZ Point pointing device buttons
Optional fingerprint reader

EZ Pad touchpad

Status indicators
Inform you when a drive is in use or when a button has been pressed that affects how the keyboard is used. For more information, see Status indicators on page 32. Press to turn the power on or off. You can also configure the power button for Standby/Resume mode. For more information, see Starting your notebook on page 29. Provides all the features of a full-sized computer keyboard. For more information, see Using the keyboard on page 33. Provides all the functionality of a mouse. For more information, see Using the optional EZ Point pointing device on page 42.

Power button

Keyboard EZ PointTM pointing device (optional)

Keyboard area Component

Fingerprint reader (optional) EZ PadTM Touchpad EZ PointTM pointing device buttons (optional) Multi-function buttons
Provides enhanced security. For more information, see Using the optional fingerprint reader on page 46. Provides all the functionality of a mouse. For more information, see Using the EZ Pad touchpad on page 38. Provides all the functionality of mouse buttons. For more information, see Using the optional EZ Point pointing device on page 42. Press these buttons to open programs assigned to them. These buttons are set to open your default e-mail program, your default Web browser, online help, and the My Computer window. For more information, see Multi-function buttons on page 37.

Bipytqtyrxipw

Important The labels shown in this section are for informational purposes only. Label information varies by model, features ordered, and location.

@fpfxipwfyiptfwyxgp

Sspwfgpwyspgxqypgvhyftytyqxftysf tipytqtpypgvxipwfyitqpfp@fpfSphsythfw Rtwwyppisttyqxftytqhfwwqftfyhp

Gateway model number

@fpfptfwyxgp

Xhfywhfpsp@fpfptfwyxgp'

Itypiyfstpthvpyspgxgfhvqypgv ItypiysphxptythpsfhfxptsypgvSsp tythpfwhyftyhxpB7yxgp

Identifying your model

Bypyfwtpwpwfgpw
4wfgpwtxtwfspqwwtyrtyithfpypgvhyftyf tpwphxxythftyipthpSspwfgpwtwhfpiyspgxq ypgv

Fthq6ptqthfpq4spytht

SspFthq6ptqthfpq4spythtwfgpwqyiyspgxq ypgvtyhwipspihvphipqpftyrpx

9tyityrphtqthfty

9xptyqxftyfgypgvhsfxpxtp xpxpfyisfiitptptt@fpf pRfrpf rfpfhxSsp pRfrpfwsfwtyvfiittyfw @fpfihxpyftyfyiipftwpiphtqthfty9xp tyqxftyppiTtyrpRwyfrp !

Accessories

4hhptp
Sipfhhptpttsp4hhpRpffhhptprfpfhx
5fptp and automobile/airplane power adapters Bqyypgvygfppqppyipipti xffygfyfiittyfwgfphfyfgfptpspy yphpfRppi6sfyrtyrgfptpwyfrp $%qxptyqxfty fgtyrfyfiittyfwxftygfpfyifphyifgfpty ypgv
Vtsfyfxgtwpftwfyppfifphfyfpgfpp gwrrtyrypgvtyfyfxgtwphtrfppwtrspfy ftwfyptyqwtrspphpfhwp
6ftyrhfp @fpfsfwfrphffhthftyrhfptqyppifiittyfwfhp qfhhptpwtp Fpx Efrprfxhsfxwtxpitfrfxprfsthrfxpf wqxpxBqrfxfpyytyrxpwwsfystyv spswifiityrxpxpxRppi4iityrpwfhtyr xpxwyfrp %$qxptyqxfty Iptspfwipthp Xhfyffhsipthphsffvpgfixptypxyt ypgvtyfwpwthf Ipwthf 4wsrshfyffhsipthpitphwypgvf pwthfwpxfvpfwwqsphyyphtyfyptxpVspy fpwtsypgvxppwithyyphqxsp pwthftypfiqywrrtyrfwwspipthp
4pwthffwtipfiittyfwfyisppfyty qpfpytyhwipitsypgvRppiTtyrspHtyfwI Qpwthfwyfrp &"qxptyqxftyfgtyrfpwthf tsypgv
Ityp XhfyffhsfwxfypqtypypgvSspx hxxypfptyvupfyiwfptypsthstytyhwgwfhv fyistp
Byvuptypfyihftirpfppwftpwtyppytpgspfp wpsfywfptypTtyrfytyvuphwtyphfyty thpgfyypfyirpptyrhfifpwwfihxpy Efptypfyihftirpfpxpppytpgsptyxhs qfpsfytyvuptypEfptypfpgppsfytyvuptyp spyfptytyrwfrpihxpy
TR5qwfsitp TpfTR5qwfsitpqtyrqtwpfyqptyrqtwpfysp hxp

@ptyrRfpi

6yyphtyrsp46fifp Sytyrypgvyfyiqq Ttyrspftyithfvpgfi fyisp8YIfihsfi 4iutyrspwxp Sytyrtpwpypvtyryfyiqq
Chapter 3: Getting Started

6yyphtyrsp46 fifp

Xhfyyypgvtyrfy46 fifpypgv gfpSspgfpfstpiftfwwhsfrpiXswip sp46 fifptrsffqwwhsfrpspgfp4wwspp s qspgfpqwwhsfrp
Important If the battery is not fully charged before you use your notebook on battery power for the first time, the battery life may be much shorter than you expect. If the battery life seems short even after being charged for three hours, the battery may need to be recalibrated. For information on recalibrating the battery, see Recalibrating the batteries on page 77.
To connect the AC adapter:

1 6yyphspphisp46 fifp

Caution
Make sure that you use the AC adapter that came with your notebook or one of the same type purchased from Gateway. Replace the power cord if it becomes damaged. The replacement cord must be of the same type and voltage rating as the original cord or your notebook may be damaged.
Connecting the AC adapter
2 6yyphsp46 fifpypgvphyyph

3 Iwrspphityffwwwp

SspgfphsfrptyithfyyppiRftyithfwy frp qspwhftyqspgfphsfrptyithf
4 Vspyqtytstyrypgvqspqttxpyqq
ypgvfyiwpfpypgvhyyphpi46 pytwsp gfphsfrptyithfyrppy
Warning Do not attempt to disassemble the AC adapter. The AC adapter has no user-replaceable or user-serviceable parts inside. The AC adapter has dangerous voltages that can cause serious injury or death. Contact Gateway about returning defective AC adapters.

4ffqspprwffhpfrfxhsphvspitv fyfxfthfwwVspysphsphvfpqtytspiVtyi f

Rftyithf

Rftyithftyqxspyfitptgptyrpispyfgy sfgppyppisffqqphsspvpgfitpi
Hard drive Caps Lock Module Scroll Lock Pad Lock

Indicator

Module Hard drive Caps Lock
Indicator Green - The module is in use. Indicator Orange - The module is ready to swap.
The hard drive is in use. Caps Lock is turned on.

Scroll Lock

Scroll Lock is turned on. For more information, see System key combinations on page 35. Numeric keypad is turned on. For more information, see System key combinations on page 35.

Pad Lock

Using the keyboard

Ttyrspvpgfi

Xypgvqpfpfqwwtpvpgfisfqyhtyspfxpff ipvhxpvpgfiFfyqspvpsfpgppyftrypi fwpyfpqyhtytyhwityrshvpqVtyiqyhtyvp qphtqthpxpftyfyispGxEhvvpqspyxpth vpfi XhfyffhsfyppyfwvpgfispypgvtyrfTR5 XiyyppisiyspypgvhyyphfTR5vpgfi Xhfyfwffhsfyppyfwvpgfityfwpwthf tyrfTR5IR
Function keys/System keys Navigation keys/Volume keys

9G key

Windows key

Numeric keypad

Application key
Arrow keys/LCD brightness keys
SspvpgfisfppfwitqqppypqvpRxpvppqx phtqthfhtyspyppifwypfyispfhtyspyppity hxgtyftytsfyspvp

Key type

Function keys
Press these keys labeled to to perform actions may open help. in programs. For example, pressing
Each program uses different function keys for different purposes. See the program documentation to find out more about the function key actions. System keys Press these colored keys in combination with the G key to perform specific actions. For more information, see System key combinations on page 35. Press these keys to move the cursor to the beginning of a line, to the end of a line, up the page, down the page, to the beginning of a document, or to the end of a document. Press these colored keys in combination with the G key to increase or decrease the volume or to turn off all sound. Press the G key in combination with a colored system key (such as S4STR, S4G75X, or 4TR8) to perform a specific action.

Navigation keys

Volume keys
Press this key to open the Windows Start menu. This key can also be used in combination with other keys to open utilities like (Search utility), (Run utility), and (Explorer utility).
Press this key for quick access to shortcut menus and help assistants in Windows. Press these keys to move the cursor up, down, right, or left. Press these colored keys in combination with the G key to control the screen brightness.
Arrow keys LCD brightness keys

Rpxvphxgtyfty

Press and hold 9G, then press this system key. To.
Vspypsp 9Gvpfyifpxvpfspfxptxp ypgvpqxspfhtytipytqtpigsphwpipthyy spvp
Display the power status box in the upper-left corner of your display. The box shows the battery charge level, the BIOS version, and whether the AC adapter is being used. Press the key combination again to close this box. Toggle the notebook display between the LCD, an external monitor or projector, or both displays at the same time. A monitor or projector must be plugged into the monitor port on your notebook. For more information, see Viewing the display on a projector or monitor on page 66. Enter Standby mode. Press the power button to leave Standby mode. For more information, see Changing power modes on page 83. Turn on Pad Lock so you can use the numeric keypad. Press this key combination again to turn off Pad Lock. The Pad Lock status indicator appears when this function is turned on. Pause the text scrolling in a DOS screen. Press this key combination again to continue scrolling. The Scroll Lock status indicator appears when this function is turned on. (This function is only available in some programs.) Pause execution of a DOS program. (This function is only available in some programs.)

tpwpypvtyrhwthv Disableyqqtpwpypvtyr

Ttyr7tpfyiI

6sfyrtyrxiwp Ttyr677U7itp Ttyrfitvppitp Ttyrfxpitfhfipfip TtyrfI66fi Utptyrspitwfyfxyt uphpwptty
Chapter 4: Using Drives and Ports

6sfyrtyrxiwp

Xypgvxiwfgfitqqppygfxiwphsff 7U7itphxgtyfty7U767QVitpphifgwp7U7itpf phyisfiitpfitvppitpfxpxhfipfipfphyif gfp

Modular bay latch

To change bay modules:
1 Bqfppxtyrfithitpitvppitpfxpxhfi
pfipxfvppsfspxiwptpx fppxtyrspyhwthv Stop

2 6wthvsppxpsfifp

thytyspfvgfspitp
SyqqypgviywfhpttyRfyigAtgpyfp xip

Changing modules

Important If the remove hardware icon does not appear on the taskbar, click the show hidden icons button.
3 6wpspE67fypw 4 7thyyphypgvqxsptyfwpwthfpp
i7thyyphtyrqxsppwthfwyfrp
5 Syypgvpspgxtqfhtyr 6 Rwtipfyiswispgfxiwpwfhshwpspgfhvq
7 RwtipspspgfxiwppwpfpwfhsSspxiwpxp

8 Rwtipspgfxiwp

9 9txwsspypgfxiwpftrstyspgfytwsp

wfhsphwthvtywfhp

10 Syypgvp
Using the CD or DVD drive
11 Qphyyphsptyfwpwthf 12 HpyspE67fypw 13 Bqypgvtyhwthv OKhytypvtyry

ypgv HQ Bqypgvtqqyty

Ttyrsp677U7itp
Xhfypypgvpyuftipftpqxwtxpitf qpfp

Bipytqtyritpp

X@fpfypgvxfhyftyypqspqwwtyritpp Evyspqyqspitpqypxpqspqwwtyrwr'
If your drive has this logo. This is your drive type. CD drive Use your drive for.
Installing programs, playing audio CDs, and accessing data. You cannot use this drive to create CDs or DVDs or play DVDs. Installing programs, playing audio CDs, playing DVDs, and accessing data. You cannot use this drive to create CDs or DVDs.

DVD drive

Chapter 4: Using Drives and Ports If your drive has this logo. This is your drive type. Combination DVD/CD-RW drive Use your drive for.
Installing programs, playing audio CDs, playing DVDs, accessing data, and recording music and data to recordable CDs. You cannot use this drive to create DVDs. Installing programs, playing audio CDs, playing DVDs, accessing data, recording music and data to CD-R or CD-RW discs, and recording video and data to DVD-R or DVD-RW discs. Installing programs, playing audio CDs, playing DVDs, accessing data, recording music and data to CD-R or CD-RW discs, and recording video and data to DVD-R, DVD-RW, or DVD-RAM discs. Installing programs, playing audio CDs, playing DVDs, accessing data, recording music and data to CD-R or CD-RW discs, and recording video and data to DVD-R, DVD-RW, DVD+R, or DVD+RW discs.

Viewing the display on a television
5 6wthvStartspyhwthvControl PanelSsp6ywIfypwtyipy
Bq6ywIfypwtty6fprUtphwthv Appearance and Themes py
6 6wthv7gwphwthvspDisplaythySsp7twfIptpitfwrg 7 6wthvsp Settingsfg
8 6wthvAdvancedSspFwtwpFytfyi4SBFgtwtQfipy&#

itfwrgpy

9 6wthvsp Displaysfg

Enable TV TV

10 6wthvsp8yfgwpSUgytqttyfwpfipyfgwpi
Important If the Enable TV and TV buttons are grayed out, your notebook has not detected the television. Make sure that the television is turned on and connected correctly.
11 6wthv TVxfvpfyfiuxpyspSUptyr
If you are traveling internationally, you may need to change the video standard. For example, many televisions in Asia use PAL instead of NTSC.
12 6wthv Apply 13 6wthvOKhwpspFwtwpFytfyi4SBFgtwtQfipy&#

itfwrg

6sfp"

FfyfrtyrIp

6sphvtyrfyiphsfrtyrspgfp Qphfwtgftyrspgfp 6sfyrtyrgfptp 8pyityrspwtqpqspgfp
Chapter 5: Managing Power

Fyttyrspgfphsfrp

Xyp@fpfypgvtiptrypitipfyphptyfw gfwfyhpqpqxfyhpfyifgtwtXypgvpspwfp hstpfyixgtwphpphsywrtpxfyfrpsphpppi fyiphyxtyqfrpfpgfpwtqppptpyhpSstiptry tiptsxftxxpqxfyhpspywrrpity46p gfwfyhpitstxtpigfpwtqpspyygfpp 6wpwxytspgfphsfrpVspyspgfphsfrprpw hsfyrpspgfphyyph46 ptxxpitfpwppywtyr fyyfpiv Sxytspgfphsfrp'
7gwphwthvspphithy gfpthy tysp fvgfSsp Ip Fppitfwrgpy
Important If the power cord or battery icon does not appear on the taskbar, click the show hidden icons button. If the icon still does not appear, make sure that Always show icon on the taskbar is checked on the Power Options Properties Advance tab. For more information, see Changing advanced settings in Using Your Computer which has been included on your hard drive. To access this guide, click Start, All Programs, then click Gateway Documentation.
Ip9GRS4STRtpsppfgsthspytysp pwpqhypqsphppySsppfgssp hpyphpspgfphsfrpwppwfyispp xfyfrpxpyxip Evfspgfphsfrptyithf' E87rppyxftyfyityfwphyifgfpfpqww hsfrpi E87fyrpxftytyfwphyifgfpthsfrtyr E87gwtyvtyrpixftyfyityfwphyifgfphsfrp fppw E87wtipixftytyfwphyifgfpt xfwqyhtytyr
Monitoring the battery charge
Important This LED only lights up when the notebook is connected to AC power. For the location of the battery charge indicator, see Front on page 10.
Ipspgfpxppgyyspxftygfpfyityfw phyifgfpSspgfpxppwtrstyithfpspphpyfrp qgfphsfrppxftytyr

4 Syypgvpspgxtqfhtyr 5 Rwtipspgfppwpfpwfhs

6 Etqspgfpqspgf

7 Iwfhpfphsfrpigfptyspgffyipiyytwtyf

tywfhp

8 Syypgvp 9 Qpffhssptyfwpwthf 10 HpyspE67fypwfyipsppgy

Extending battery life

Byfwwtyrfphyifgfp
XypgvxiwfgffhhpfphyifgfpSsp phyifgfphsfrpspyspypgvthyyphpi 46 p
To install a secondary battery:
Rfspphyifgfpqfgfxiwpgqwwtyrsp tyhtytyi6sfyrtyrxiwpwyfrp "

8pyityrgfpwtqp

6yptyrgfpp

Shypppstwptyrspgfppypgv'

7txspitwffwfthxqfgwp QpxpI6 6fifyiB5FFthitphfispyiyyppi spxFfyI6 6fifyiFthitphfipfxfwwfxyq pstwptyppippytqspfpygptyrpi Fitqsppxfyfrpxpyptyrqxftxxp ftyr
Tips & Tricks For more information about using power management settings, see Changing Power-saving Settings in Using Your Computer which has been included on your hard drive. To access this guide, click Start, All Programs, then click Gateway Documentation.
6wpspE67fypwyqqspitwfstwpfpytyr ypgvSspitwffqqytwpyspfypwfrfty TpAtgpyfpxipqxftxxpftyrstwp ypgvtytyp
Tips & Tricks For more information about using Hibernate mode, see Activating and using Hibernate mode in Using Your Computer which has been included on your hard drive. To access this guide, click Start, All Programs, then click Gateway Documentation.
Ttyrsp677U7phifgwpitpywspyyphpfSspp itppfwfrpfxyqp Qphsfrpspgfpqpyfvpfypfgfpfyiqwwphsfrp spgfptpgpqpfpwtyr9xptyqxftyppiQphsfrtyr spgfptpwyfrp $#fyii6sfyrtyrgfptpwyfrp $%

Ttyrfwpyfpphp

Sppyigfpwtqppfwpyfpphpspypptgwp
BqfpwtyrtypyftyfwwfvppwphthfwfifpRfpspgfp qtxpspyhfyypfpfifpBqwfyyfvtyr 46 pfifpfwfvpftyrwpwrrpph Bqtwwsfpfhhpfy8xIptyqwtrspphpfhwp fyfxgtwphtrfppwtrsppfptyppRfpsp gfpqtxpspyhfyypfpfifp Sqtyi46 pwptyftwvqspxyp twwftywfrpfpfhsfgfityrrfpfyiyipgfyvq pwpsyp

6sfyrtyrpxip

Xhfypspqwwtyrpxipwpyrspyspwtqpq ypgvgfp'
stwpypgvttyRfyigtthspfw pfpsppipthphsfspitwffyiitpyqq AtgpyfpfwhfwwpifpitvtpfwwhpyxpxQ4F tyqxftyspsfiitpspyyypgvhxwppw qqSspyptxpyyypgvtpfispxpx tyqxftyqxspsfiitpfyipysprfxfyi ihxpysfpppyspyfhtfpiAtgpyfpxip

Ttyrpftyrxip

4wffpvgpqptyrRfyigxipByRfyigxip ypgvpihpyqqsppxipthpphp xpxAppsptyqxftytyxpxtyfpispsfi itpBqpttyppisptyqxftytw VspytyAtgpyfpxipypgvfpfwwxpxtyqxfty spsfiitpspyyspphxwppwqq

If your notebook is.

.and you want to.
Enter Standby mode Enter Hibernate mode (must be activated) Exit Standby or Hibernate mode

Press G

9 RS4G75X.
Click Start, then click Turn Off Computer. Press and hold AB9S, then click Hibernate.
In Standby or Hibernate mode

Press the power button.

TrfityrXGpgv
4iityrfyipwfhtyrxpx Qpwfhtyrspsfiitp
Chapter 6: Upgrading Your Notebook
Ippytyrfthpwphtht ithsfrp

Important Before installing memory or replacing the hard drive, you should read and understand the information in this section.
Ssphxypytytipypgvfpppxpwpyttpfth pwphthtfwvyyf pwphfth ithsfrp8R7
Warning To avoid exposure to dangerous electrical voltages and moving parts, turn off your notebook and unplug the power cord, modem cable, and network cable before opening the case.
To prevent risk of electric shock, do not insert any object into the vent holes of the notebook.
5pqptyfwwtyrxpxpwfhtyrspsfiitpqwwspp rtipwtyp'
4tifthhftyrqfhphsfhfppiqwwfthfyi fhvtyrqfx Qpxphxypyqxsptfytfthgfrywspyfp pfipspx7ywfhxypyysptipq fytfthgfrgphfpywsptytipqspgfrtip pwphfthphty 4wfswihxypygsptpirp4tihstyrsppirp hyyphGppwtiphxypypfyqfhp Vpffryityrtffftwfgwpfxpwphythp fyiffhstfgfpxpfwfqvgpyhssp ryipihyyphty Shsfgfpxpfwqfhpyvgpyhsspryipi guph
Adding or replacing memory

4iityrpwfhtyrxpx

XypgvpxpxxiwphfwwpiRH7BFFRxfwwHwtyp 7fwBywtypFpxFiwpSspxiwpfpfftwfgwptyft hffhttpfyifyxiwphfygpwfhpityfyfftwfgwpwTpyw xpxxiwpiptrypiqsp@fpf !"QH@ @fpf !"Q@Aqrfityrxpx

Memory bay

To add or replace memory modules:
1 9wwsprtipwtypyipiIppytyrfthpwphthtithsfrpw

yfrp %#

Syqqypgv 7thyyphsp46fifpxipxhfgwpfyiypvhfgwp 7thyyphfwwptspfwipthpfyipxpfyI6hfi 7thyyphypgvqxsptyfwpwthfpp i7thyyphtyrqxsppwthfwyfrp
6 Syypgvpspgxtqfhtyr 7 Qpxpspxftyfyiphyifgfptp9xptyqxftypp

i6sfyrtyrgfptpwyfrp $%

8 EpyspxpxgfhphpSsthphfyygppxpi
9 Qpxpspxpxgfhp 10 Bqfppxtyrfxiwprpywpfiysphwtf
pfhspyiqspxpxxiwpytwspxiwptwfi

11 Iwwspxpxxiwpqspw

12 Awispyppwfhpxpyxiwpff iprppfyrwpfyip
ttysppxxpxwSstxiwptvppithfyyw gptyppityypitphtyBqspxiwpipyqtxfvpp sfspyhstyspxiwpwtyptsspfgtyspxpx gf
Important Use only memory modules designed for the Gateway 450ROG or Gateway 450RGH.
@pywsspxiwpiyytwthwthvtywfhp Qpwfhpspxpxgfhpfyitrspysphphp Bypspgfptpspyyypgvp Qphyyphsptyfwpwthf 6yyphsppfifpxipxhfgwpfyiypvhfgwpspy yyypgv

Qpwfhtyrspsfiitpvt

Bqwiwtvpxpsfiitphffhthfypwfhptrtyfw itptsfstrsphffhtitp

Hard drive

To replace the hard drive kit:
1 5fhvfyifffyfyqpspypsfiitp9
xptyqxftyppi5fhvtyrqtwpwty Ttyr X 6xp sthssfgppytyhwipiysfiitpSfhhpstrtip hwthv Start All Programsspyhwthv Gateway Documentation yfrp %#
2 9wwsprtipwtypyipiIppytyrfthpwphthtithsfrpw 5 6
Syqqypgv 7thyyphsp46 fifpxipxhfgwpfyiypvhfgwp 7thyyphfwwptspfwipthpfyipxpfyI6hfi 7thyyphypgvqxsptyfwpwthfpp i7thyyphtyrqxsppwthfwyfrp
Replacing the hard drive kit
7 Syypgvpspgxtqfhtyr 8 Qpxpspxftyfyiphyifgfptp9xptyqxftypp

9 Qpxpspsfiitpvthp

10 Rwtipspwisfiitpvtqypgv
11 Bqypsfiitpfwpfityhwipspsfiitpvtgfhvp
rRp # HQ Bqyppixpspsfiitpvtgfhvpqxwisfi itpvtypsfiitprRp

12 Qpxpsphpsfphpspsfiitpspsfiitp

vtgfhvp

Screw Screw

13 Qpxpspgfhvpqxspwiitp

14 Bypspypitptyspgfhvpsphpswpwtypfyi
spwfthtyspqspgfhvptttypifsy

Plastic strip

Qpwfhpsphpsfphpspgfhvpspitp Rwtipspypsfiitpvttyypgv Qpwfhpsphpsfphpspsfiitpvtypgv Bypspgfptpfyiyypgvp Qphyyphsptyfwpwthf 6yyphsppfifpxipxhfgwpfyiypvhfgwpspy yyypgv fwthftyppsptyhtysfpptyhwipitssppp ith
21 9tyhtyytyfwwtyrVtyiitpfyi

TtyrspHtyfwI Qpwthf

Bipytqtyrqpfp 6yyphtyrfyiithyyphtyrsp pwthf Rphtyrsppwthftsfwhvtyr hfgwp
Chapter 7: Using the Optional Port Replicator
Docking release latch Docking release latch
Docking release latch Docking port
Press both release latches to release the notebook. Connect the notebook to this port. Warning! Power is passed through this port. This docking connection is certified to UL 1950 for use only with notebooks designed for your Gateway port replicator.

Power connector

Plug the AC adapter cable into this connector. Important: The power connector may be located on the back of your port replicator.
PS/2 keyboard port PS/2 mouse port USB ports
Line in jack Modem Headphone jack jack S/PDIF digital Ethernet audio jack jack Power connector

S-Video out jack

PS/2 keyboard port
Plug a PS/2 keyboard into this port. Attaching a PS/2 keyboard to your port replicator may deactivate the built-in keyboard. Plug a PS/2 mouse into this port. Attaching a PS/2 mouse to your port replicator may deactivate the touchpad or pointing device. Plug USB (Universal Serial Bus) devices (such as a flash drive, Iomega Zip drive, printer, scanner, camera, keyboard, or mouse) into these ports. Plug a standard S-Video cable into this jack and the jack on an S-Video device. Plug an analog VGA monitor or projector into this port. For more information, see Viewing the display on a projector or monitor on page 66. Plug a parallel device (such as a printer) into this port.

PS/2 mouse port

S-Video out jack Monitor port
Plug a modem cable into this jack.
Plug a 10/100/1000 Ethernet network cable into this jack. Plug the AC adapter cable into this connector. Important: If your port replicator has a power connector on the left side (see Left on page 97), plug the Gateway 450ROG or Gateway 450RGH AC adapter into that connector. If your port replicator does not have a power connector on the left side, plug the AC adapter into this connector.

DppypgvffqxxfrypthqtpwiFfrypthqtpwihfy pfpiffysfiitp Gppyqqypgvspyspsfiitpwtrstygphfp iffyspsfiitphwigpwhpi 4tiguphtyrypgvppxppxpfphsfyrp SsphfpfyiE67fypwhfygphxpgtwpfyipfgpfvty hwipxpfpfyihfyxpwftystrspxpfp 7fxfrpipptspppxptyhppigffy4 frpypfwwpypgvtfqpfpxpfpsffp hxqfgwpq DppfwwwttiffqxypgvVspytwwpiy ypgvhxypyfwxfywttihfypwtyppxpw ppytppftsffpyhppiyipffy 4tiiitvpytyxpy7fyiithfyhwrsp typyfwxphsfytxfyihfywpfipxfypyifxfrpsp ypgv 7ygwhvsppytwftyqfywBqsppwfpgwhvpi ypgvxfpspfpwtyrtyypphpisiy pxfypyifxfrpspypgv Vspytyrypgvqfyppyipiptiqtxpywr 46 pfyipxpspgfpfqpithsfrtyrtff

Cleaning your notebook

6wpfytyrypgv
Dpptyrypgvhwpfyfyisppyqppqxispwvpp ypgvpqxtyrftgpXxffyrfspspptpx fyirpspfypgvhwpfytyrvt'
4qwtyqpphws 4yfpwhfyqftsfsffyffwtvpppyty 6yfg 47U7itphwpfytyrvt

6wpfytyrspppt

Warning When you shut down your notebook, the power turns off, but some electrical current still flows through your notebook. To avoid possible injury from electrical shock, unplug the power cord, modem cable, and network cable from the wall outlets.
4wfyqqypgvfyispptspfwgpqphwpfytyrfy hxypy4wpxpspgfpgpqphwpfytyrfyhxypy Tpfifxwtyqpphwshwpfyypgvfyispfq px7ypspswifgftpwpyhwpfypgphfp sphfyifxfrpspqtytsyhxypy Xypgvthwpigfththwfpisrssppyysphfp vppsppyqppqiVtsypgvypiqqfyi ywrrpigsspiffqxsppytsfifxhws5p hfpqwyitfyfptysppy7yfpxhwpfyi qxsptytipqypgv

6wpfytyrspvpgfi

Xswihwpfyspvpgfihhftyfwwgtyrfyfpwhfyq fttsfyffwtvpppytypxpifyiwtyfpi yipspvp Bqtwwwttiyspvpgfiyqqypgvfyiysp ypgvtipiyEpspwttiiftyspywpspvpgfii gpqptyrptfrftyBqspvpgfiipyvfqptitp xfyppipwfhp t

6wpfytyrspypgvhppy

ShwpfyfypgvE67hppypfqhwsfyifphwpfysp E67hppyRtfwtwpfpysphwsyppitphwysp hppyfyitpsphppytssphws
Caution A notebook LCD screen is made of specially coated glass and can be scratched or damaged by abrasive or ammonia-based glass cleaners.

6wpfytyr677U7

Vtpqxsphpypsppirpyfyityfhthwptyrfih xfippphtfwwqspp
Protecting your notebook from viruses

Iphtyrypgvqx tp

4 ttfrfxsfffhsptpwqfqtwpyfhxpspy pfiqxyphxpfyspUtphfyifxfrpiffhfp ypgvxfwqyhtyRxptpryipphpiqfpti qtxpgphfpspfpfhtfpiyfhpftyifp Iphypgvqxftg'
QprtptyrhqGy4ytUtfyightgtyrsp tipqtyttyifppthpXphptpifqppwtxtpitxp ghttyspGy4ytUtpthpspyhsfpi ypgv TtyrspGy4ytUtrfxhsphvqtwpfyirfx sffpffhspipxftwxpfrpiywfipiqxsp Bypyp 6sphvtyrfwwrfxqtpgpqptyfwwtyrspx 7tfgwtyrxfhythtFthqVifyi8hpwqtwp Sspprfxtwwfytqfihxpysffppytyr hyftyfxfhsfxtrssfpft IptithfwwiftyrspGy4ytUtrfxph frftyspwfptp FfvtyrpspVtyiRpht6pypthyqtrpitip tsspstrspwppwqphty
Tips & Tricks For more information about modifying security settings, see Modifying Security Settings in Using Your Computer which has been included on your hard drive. To access this guide, click Start, All Programs, then click Gateway Documentation.

To check the dialing properties:

and Other Hardware

pyBq6ywIfypwtty6fprUtphwthv Printers
2 6wthv7gwphwthvspPhone and Modem Optionsthyspyhwthv

sp Dialing Rulesfg

3 6wthvspwhftyqxsthsfpitfwtyrspyhwthv Edit 4 Ffvppsffwwptyrfphph
For more information about dialing properties, click Start, then click Help and Support. Type the keyword itfwtyr in the Search box , then click the arrow.
7thyyphfyfyptyrxfhstypqfxfhstyptypsft yspfxpwtypfspxipx7yhyyphsppipthp spfxppwpsypwtypfspxipx FfvppsffpytyrfitrtfwwwpI5W wtyp Ssppwtypiyvtsxipx
6sphvqwtypytphfhshfhvwtyrtyryiEtyp ytptfhxxygwpxsfhfyhfpspxipxhyyph ffwpfpfgiywfippyithyyphSspqfpsp xipxspwpwtypytpthfywpfpfyitwwvhphw Etpyspwtyptyrpwpsyp7tfwftyrwpyxgphs f VspyspitfwypwtpyqwtypytpVtrrwpsp xipxhfgwppptqsfxfvpfitqqppyhpFfvppsfsp hyyphfpqppqxhtyfyifwwhptyspfww pwpsypfwwufhvfpphp Xhfyfwhfwwpwpsyppthpfyisfpsppwpsypwtyp hsphvpiqytpwwtypwppw
Sfysppwpsypwtypptspfitqqppypwpsypyxgpty spfpwpsypwtypffitqqppywhftyBqhfy hyyphystwtyphfwwpwpsyppthp ShyyphtyrtsspxipxffwphyyphtyppiBq pihtyrsphyyphppiwphyyphhfwwpwpsyp pthpSsppwpsypwtypxfgpyt
XhfyyhyyphspBypyp SspBRIxfgpsftyrphsythfwitqqthwtp6yfhBRIq phsythfw Rpptqspxipxvtsfitqqppyhxxythftyrfx Sspgwpxxfgptsuyprfx QptpspgwpstyrtyqxftyyipiBypypwy frp X"#Dxipxipyhyyphf"#D 6py966prwftypthfhfwifffyqpfppgwth pwpsypwtyp" DHspqfhhsfwtypytppwpsyppthp tipptxpyBRIwtxtftyxfwpspppippyqsp
Bqypgvsff&xipxspppifsthshfywfi pyiifftwtxtpi #DBqypgvsff&xipxsp ppifsthshfywfiifftwtxtpi!%DXBRIxfy !%Dwfi
Xqfhxxythftyrfxywpyifyiphptpqfpf !! gspysfpf"#Dxipx 6pyqfphsywrywfxftxxpyifyiphptpfp q!! g Sspxipxtyphrytpigypgv Ffvppsfspwtyphyyphpispxipxtvtyrfyi wrrpityspftfpyypgvRppi5fhvwy frp !xfvppsfsphyyphtysfpgppyxfiphphw Bqspxipxsfpsppwpsypwtyptsfyspipthpxfvp psfsppwpsypwtyptytypqpfxwpxpypt ysppwpsypfyspxipxttyp TpspxipxhfgwpsfhfxptsypgvRxp pwpsyphfgwpiyxppptpihfgwpfyififyixf hfpgwpxtsspxipxhyyphty Rsiyfyipfypgv QyVtyixipxitfryth
To run modem diagnostics:
1 6wpfwwpyrfx 2 6wthv Startspyhwthv Control PanelSsp 6yw Ifypwtyi
3 6wthv7gwphwthvspPhone and Modem Optionsthyspyhwthv

sp Modemsfg

4 6wthvxipxspyhwthvPropertiesSspFipxIptp
5 6wthvspDiagnosticfgspyhwthvQuery ModemBqtyqxfty
fgspxipxfpfspxipxfpiitfrythBqy xipxtyqxftytfftwfgwpfstphppyfpftsy ifftqrpfyphsffwpfipyspxipx sf qftwpi pyispxipxitiyfitfryth
Help and Support For more information about modem troubleshooting, click Start, then click Help and Support. Type the keyword xipxgwpstyr in the Search box , then click the arrow.

Every country has different restrictions on the use of wireless devices. Since your system is equipped with a wireless device, when traveling between countries with your system, check with the local Radio Approval authorities prior to any move or trip for any restrictions on the use of a wireless device in the destination country.

TytpiRfpq4xpthf

9pipfw6xxythfty6xxtty966Bypytyfwpxtpp966If "
EpQfitfyxtppipthpfitqppyhQ9tpwphxxythfty ipthppftyrtysp! @Agfyifyi"" o " " @Agfyixfgpppy pxgpiipityypgvpxSstphtytywfwthfgwptqsppipthpfp ppyQpqpsppxwfgpwptqspppyhpqtpwpipthp VtpwpipthpsfxfgptypxfpywfwtqtpiqptyspTytpiRfp q4xpthftqfy966B7 yxgptysppxwfgpw Ssp966sfpfrpypfwrtipwtypq hx% tyhsppfftygpppyspipthpfyi spgiqpqftpwpipthpypfspgistipytyhwipppxttpSst ipthpswigppixpsfy hx% tyhspqxspgispytpwpipthpfp ySsppqsptpwpipthpipthpsthsxfgppxgpiipity ypgvtpwwgpwspQ9ppwtxtfpgsp966 SsptpwpipthptyfwwpitystpxfptypyipigppityiByxpfpf pqsppipthpitstgtpi Hpftyqstipthptguphspqwwtyrhyitty'Sstipthpxfy hfpsfxqwtypqppyhpfyistipthpxfhhpfytypqppyhpphptpi tyhwityrtypqppyhpsfxfhfpyiptpipftyqspipthp
Caution Wireless devices are not user-serviceable. Do not modify them in any way. Modification to a wireless device will void the authorization to use it. Contact Gateway for service.
The transmitting device embedded in this system may not be used with any antenna other than the one provided with the system.
Caution In order to comply with FCC requirements this transmitter must not be operated (or co-located) in conjunction with any other transmitter or antenna installed in the notebook.
Tytypytyfwpxtpp966If "
Sstipthpsfgppyppifyiqyihxwtsspwtxtqf6wf 5itrtfwipthp fyIf "qsp966wpSsppwtxtfpiptrypitippfyfgwp phtyfrftysfxqwtypqppyhptyfptipytfwtyfwwftySstptxpy rpypfppfyihfyfitfpfitqppyhpyprfyitqytyfwwpifyipity fhhifyhptssptyhtyxfhfpsfxqwtypqppyhpfitpwptty phptyAppspptyrffyppsftypqppyhptwwyhhtyffthwf tyfwwftyBqstptxpyiphfptypqppyhpfitfyipwpttyphpty sthshfygpippxtypigytyrspptxpyqqfyiyspptpyhfrpi hphsptypqppyhpgypxpqspqwwtyrxpfp' Qptpypwhfpspphpttyrfypyyf Byhpfpsppfftygpppyspptxpyfyiphptp 6yyphspptxpytyfywpyfhthtitqqppyqxsfsthssp phptpthyyphpi 6ywspipfwpfypptpyhpifitSUphsythtfyqspw 6xwtfyhp4hhptp'Sspfhhptpfhtfpitsstptxpyfp'stpwipi tiphfgwpspyfyppyfwxytthyyphpiSsppfhhptpfpptpigp pityippyphxwtfyhpts966wp
966iphwfftyqhyqxt Qpytgwpf'
@fpf6xfytpByh #@fpf7tpGsRt6tR7"$!& #" 9f'#"
@fpf !"Q@A @fpf !"QH@ SstipthphxwtptsIf "qsp966QwpHpftyqstihtguph spqwwtyrhyitty'stipthpxfyhfpsfxqwtypqppyhpfyi stipthpxfhhpfytypqppyhpphptpityhwityrtypqppyhpsfxfhfp yiptpipfty

Caution To prevent radio interference to licensed service or co-channel Mobile Satellite systems, this device is intended to be operated indoors and away from windows to provide maximum shielding. Equipment (or its transmit antenna) that is installed outdoors is subject to licensing.
Wireless devices are not user-serviceable. Do not modify them in any way. Modification to a wireless device will void the authorization to use it. Contact Gateway for service.
The transmitting device embedded in this system may not be used with any antenna other than provide with the system.
The 802.11A radio LAN your system may have been equipped with operates in the same frequency range as high power radar, which has priority use, and may damage the radio LAN if both are present and being used in the same area. www.gateway.com

TytypytyfwpxtppB68R

Sstitrtfwfffipyphppisp6wf 5wtxtqfitytppxttyqx itrtfwffffptyspfittypqppyhpprwftyqByi6fyfif Eppyffptwyxtpyxpfipgtfitwphtpiffywpwtxtp fwthfgwpfffptwyxtpip6wfp 5phtpifywprwpxpywp gtwwfrpfitwphtpithfByitp6fyfif SspByi6fyfifwfgpwtipytqtphptqtpiptxpySsthptqthftyxpfysfsp ptxpyxpphpftypwphxxythftyypvphtppftyfyifqp ptpxpySsp7pfxpyipyrffyppspptxpytwwpfpspp ftqfhty 5pqptyfwwtyrstptxpypswixfvppsfttpxttgwpgp hyyphpispqfhtwttpqspwhfwpwphxxythftyhxfySspptxpyx fwgptyfwwpityrfyfhhpfgwpxpsiqhyyphtyByxphfpsptytip ttyrfhtfpitsftyrwpwtyptyittifwpthpxfgpppyipigxpfyqf hptqtpihyyphfpxgwSsphxpswigpffpsfhxwtfyhptssp fgphyittyxfyppyiprfiftyqpthptyxptfty Qpfthptqtpiptxpyswigpxfipgfyfstpi6fyfitfyxftypyfyhp qfhtwtiptryfpigspwtp4ypftfwpftyxfipgsppst ptxpyptxpyxfwqyhtyxfrtpsppwphxxythftyhxfyhfp ppsppithyyphspptxpy Tpswixfvppqsptyphtysfsppwphthfwryihyyphtyq spptwtpwpsypwtypfyitypyfwxpfwwthfptppxtqppyfp hyyphpirpspSstphftyxfgpfthwfwtxfytyfwfpf
Warning To avoid electrical shock or equipment malfunction do not attempt to make electrical ground connections by yourself. Contact the appropriate inspection authority or an electrician, as appropriate.
SpwphxxythftypByi6fyfif6R qihqtpitsfy B6hxwtfyxipx
SspQtyrp8tfwpyhpGxgpQ8Gftrypipfhspxtyfwipthptipfy tyithftyqspxftxxyxgpqpxtyfwfwwpigphyyphpifpwpsyp typqfhpSsppxtyftyyfytypqfhpxfhytqfyhxgtyftyqipthp guphywspptpxpysfspxqspQtyrp8tfwpyhpGxgpqfwwsp ipthpipyphppi "

 

Tags

60 CT-1 PB100 Powershot A530 PDP-502MXE CDP-C325 SC-MX10A T8132A PSC 2510 DXZ725 Focus-2001 T834V Shaker 4000 PVR CMT-SE7 VCL-HG0737K PT-LB51U Flymo L300 4X4-2002 TFT7210R Gericom G799 Handheld SLV-RX9 ET300 MS1944JL 1000 QX Network Service Manual XM-ZR602 Part2 VGN-CR23 FX-570D Series WTH CD WII ROC 1404 SRS-TP1 Cruzer4 FID 2130 Device Sagem D70V Control Yuno 20 Xserve Raid MS9307C LX700-21S Smartphone NV-VZ15 Bx1500LCD Ram CP-8660 PB7230 DA-16 Battery K618I Xw320 Specs Half Life AND HOT CQ-DFX777 Nomad Toaster DD-20 Satellite A205 NC6320 Decker LZR2 Kombat-armageddon HQ6890 L222WS-BN Mayhem UE-40C6500 NV-SD430B 20-0602 FW750C 22S TVS III Series Wl-537 Ae4000U TTR90-2001 42PFL7862D Krups GVS1 KV20EXR20 RZ-17LZ50 TA-AV790ESD Laptop EWF14780W Soundsticks FS-1562 Rrus550 AJ-HDC27F 1100P Plus RC7300 RT-28FZ85RX Conditioner Calor 7250 Manual YP-K3AB Premium 1200 HP-305 APA4320 Memory SGH-P300 ZL 85 MHC-WZ88D HBF600T DSC-W130 P1253 PS50B530 90101

 

manuel d'instructions, Guide de l'utilisateur | Manual de instrucciones, Instrucciones de uso | Bedienungsanleitung, Bedienungsanleitung | Manual de Instruções, guia do usuário | инструкция | návod na použitie, Užívateľská príručka, návod k použití | bruksanvisningen | instrukcja, podręcznik użytkownika | kullanım kılavuzu, Kullanım | kézikönyv, használati útmutató | manuale di istruzioni, istruzioni d'uso | handleiding, gebruikershandleiding

 

Sitemap

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101