Gateway M320
|
|
Bookmark Gateway M320 |
Gateway 102529 M320 40-A07040-B400 MotherboardDetails
Brand: GATEWAY
Part Number: 102529
Here you can find all about Gateway M320, for example drivers and service manual, wireless driver, keyboard, battery, bios update, manual, laptop. You can also write a review. [ Report abuse or wrong photo | Share your Gateway M320 photo ]
Manual
Preview of first few manual pages (at low quality). Check before download. Click to enlarge.
Download
(English)Gateway M320 Laptop & Notebook, size: 1.5 MB |
Gateway M320
User reviews and opinions
| alaskanwindow |
2:00pm on Wednesday, April 21st, 2010 ![]() |
| I purchased my M320X as a replacement for a s... Lightweight, excellent screen, fully optioned out. Weak screen hinges. The laptop came out of the box with a burnout backlight. I asked immediately for a replacement computer and was turned down. The laptop came out of the box with a burnout... tech support very unstable and unreliable | |
Comments posted on www.ps2netdrivers.net are solely the views and opinions of the people posting them and do not necessarily reflect the views or opinions of us.
Documents
SPECIFICATIONS
Gateway M320 Notebook
Specifications are subject to change without notice or obligation. Processor and Core Logic
Processor options
One Intel Celeron M CPU -OR-
One Intel Pentium M 705, 715, or 735 CPU To determine your notebooks processor, click Start, My Computer, then click View System Information. The processor is listed. Intel micro-FCPGA
Processor packaging Level 2 cache
512 KB (Celeron M) 1 MB (Pentium M 705) 2 MB (Pentium M 715 and Pentium M 735) Intel 852GM (Celeron M) Intel 855GM (Pentium M)
Chipset-Northbridge
Chipset-Southbridge Processor side bus speed BIOS
Intel ICH4-M 400 MHz processor system bus
Phoenix BIOS 4 MB Flash ROM SMBIOS 2.3 support Advanced Configuration and Power Interface 1.0b and 2.0 (ACPI 1.0b and 2.0) support Wired for Management 2.0 (WfM 2.0)
System memory
Memory type Memory expansion options 200/266/333 MHz DDR RAM Two 200-pin industry standard DDR-SODIMM sockets Accepts two 200/266/333 MHz DDR RAM memory modules in memory bay No internal memory 2 GB maximum system memory To determine your notebooks memory, click Start, My Computer, then click View System Information. The memory is listed.
www.gateway.com
Graphics controller
Intel 852GM (chipset integrated) -ORIntel 855GM (chipset integrated) 2D hardware acceleration 3D rendering acceleration
Video memory LCD display panel
UMA (shared memory) architecture with Dynamic Video Memory Technology (DVMT)
15.0-inch active matrix (TFT) LCD color display -OR-
14.1-inch active matrix (TFT) LCD color display Maximum panel resolution: 1024 768
Maximum color depth: 32-bit (16.7 million colors) LCD supported video modes LCD maximum refresh rate Controls XGA (15.0-inch or 14.1-inch) 60 Hz
Brightness level selectable through FN keys (up, down) Auto dim on battery and auto bright on AC power (selectable in BIOS)
External video External CRT resolutions
Supports dual display and extended desktop Supports standard IBM VGA compatible modes Maximum resolution: Maximum color depth: 32-bit (16.7 million colors)
External CRT maximum refresh rate
Sound support Analog Devices AC 97 SoundMAX Codec Multi-stream Direct Sound and Direct Sound 3D acceleration SoundBlaster Pro, MIDI, Windows Sound System compatible NOTE: This notebook does not have an internal microphone.
Volume controls
Volume control toggle Press toggle in to mute the sound Software control provided through Windows Stereo speakers built into front of notebook 1.0 W maximum output for each channel Stereo headphone output Monophonic microphone input
Internal speakers Audio jacks
Communications
Modem features
Integrated v.92 56K modem Uses the RJ-11 jack on the rear of the notebook Supports Wake on Ring from S3 power mode Integrated IEEE 802.3 (10/100 BASE-TX) Ethernet interface Uses the RJ-45 jack on the rear of the notebook Supports Wake on LAN from S3 power mode Intel PRO/Wireless IEEE 802.11b/g network card, Mini-PCI (Pentium M models only) -OR-
10/100 Mbps Ethernet interface features Wireless Ethernet interface features (Factory installed option)
Broadcom IEEE 802.11g network card, Mini-PCI (Celeron M models only) FN+F2 keyboard combination turns wireless Ethernet on and off.
Antenna: Uses factory-installed diversified internal antenna Operating channels: 11 selectable channels Security: 128 and 64 bit WEP encryption Operating Frequency: 2.4 GHz Direct Sequence Spread Spectrum (IEEE 802.11b and IEEE 802.11g) Maximum Data Rate
54 Mbps (IEEE802.11g 11 Mbps (IEEE802.11b)
Input/Output (I/O)
Keyboard
U.S. English keyboard Full-sized 88-keys 19 mm 19 mm key pitch 2.5 mm keystroke Gateway EZ-Pad touchpad with vertical scroll 2-button design
Pointing device Status indicators
FN+F1 keyboard combination turns status indicators on and off.
AC power Wireless Ethernet Caps lock PAD (Num) lock Scroll lock Hard drive access Battery status Power/Suspend
Input/Output (I/O) ports
Three USB 2.0 (4-pin) IEEE 1394 (4-pin) V.92, 56K Modem (RJ-11) 10/100 Ethernet (RJ-45) External monitor (VGA) Stereo headphone output Monophonic microphone input PC Card socket (one Type II) DC input
PCMCIA
Accepts one Type II device Ricoh R5C590 controller NOTE: This notebook does not support Zoom Video.
Storage
Hard drive 2.5-inch diameter 9.5 mm height To find the hard drive capacity, click Start, then click My Computer. Right-click the drive letter, then click Properties. The drives capacity and available space appears. If the drive has multiple partitions (for example, C: and D:), add the capacities of each partition to determine the drives total capacity.
Memory card reader (factory installed option)
Supports the following card types:
Memory Stick MultiMediaCard Secure Digital
Optical drive (factory installed)
Available drives include: Combination DVD/CD-RW Combination CD-RW/DVD+/-RW To determine the type of optical drive in your system, examine the drive trays plastic cover. A DVD logo in combination with a CD-R/RW logo indicates a DVD drive that also is a recordable/rewritable CD drive, and a DVD-ROM/R/RW logo in combination with a CD-R/RW logo indicates a recordable/rewritable DVD drive that also is a recordable/rewritable CD drive.
AC adapter
19 VDC, 3.42A, 65 W output Automatically adjusts for 100 to 240 VAC, 50 to 60 Hz power sources Two-wire design Removable Lithium Ion battery pack Embedded controller inside to support smart battery
Battery type Battery capacity
6-cell Li-Ion 4.4 Ah 11.1 V nominal 48 Whr Battery life varies depending on configuration, programs, power management settings, and features used. Recharge time varies, depending on usage.
Power management
Advanced Configuration and Power Interface 1.0b or later (ACPI 1.0b or later) support SMBIOS 2.3 PC 2001 compliant CPU may support Intel Speedstep technology
Controls Power switch Lid switch
Icon on taskbar shows battery charge as a percentage remaining Supports Power On/Off, Standby/Resume, Hibernate, Shutdown LCD On/Off, Standby, Hibernate
Security
Passwords Physical
Power-on password (user/supervisor password set in BIOS) Hard drive password Main system memory compartment screw Hard drive kit screw Mini PCI bay screw Kensington security slot on notebook back
System software
Operating system System management
Microsoft Windows XP Professional Microsoft Windows XP Home Edition SMBIOS 2.3 BIOS support Advanced Configuration and Power Interface 1.0b and 2.0 (ACPI 1.0b and 2.0) support Support for Wake on LAN from S3 power mode Support for Intel LANDesk Client manager 6.0 Wired for Management 2.0 (WfM 2.0) enabled PC2001 specification Advanced Configuration and Power Interface 1.0b and 2.0 (ACPI 1.0b and 2.0) support SMBIOS 2.3 Windows Hardware Quality Labs (WHQL) certified
System compatibility
Quick boot
Supported
Physical specifications
Dimensions ~12.9 10.5 1.0 in. (W D H) ~27.1 mm (W D H) System weight ~5.5 lbs. (~2.5 kg) Includes optical drive and 6-cell battery AC adapter weight ~11.5 ounces (~357 g) Includes cord Battery weight ~10.4 ounces (~322.5 g)
Environment
Operating temperature Storage temperature Operating humidity 50F to 90F (10C to 32C) 4F to 140F (-15C to 60C) 20% to 80% relative humidity; no condensation
MAN M320 SPECS R0 7/04

Gateway Notebook
User Guide
1 Getting Help. 1
Gateway Web site. Using eSupport. Help and Support. Searching for a topic. Using Your Computer guide. Online help. 6 7
2 Checking Out Your Gateway Notebook. 9
Top. Left side. Right side. Back. Bottom. Keyboard area. Identifying your model. Gateway model and serial number. Microsoft Certificate of Authenticity. Finding your specifications. Accessories. 18
3 Getting Started. 19
Installing the battery. Connecting the AC adapter. Protecting from power source problems. Starting your notebook. Waking up your notebook. Turning off your notebook. Restarting (rebooting) your notebook. Status indicators. Using the keyboard. Key types. System key combinations. Using the EZ Pad touchpad. Using the touchpad. Adjusting the volume. 34 36
www.gateway.com
4 Using Drives and Ports.37
Using the DVD drive.38 Identifying drive types.38 Inserting a CD or DVD.39 Playing a CD.40 Playing a DVD.40 Creating CDs and DVDs.40 Using the memory card reader.41 Memory card types.41 Inserting a memory card.41 Adding and removing a PC Card.43 Viewing the display on a projector or monitor.45
5 Managing Power.47
Monitoring the battery charge.48 Recharging the battery.49 Recalibrating the battery.49 Changing batteries.51 Replacing the battery.51 Extending battery life.52 Conserving battery power.52 Using alternate power sources.53 Changing power modes.54
6 Upgrading Your Notebook.55
Preventing static electricity discharge.56 Adding or replacing memory.57 Replacing the hard drive kit.60
7 Maintaining Your Notebook.63
Caring for your notebook.64 Cleaning your notebook.65 Cleaning the exterior.65 Cleaning the keyboard.66 Cleaning the notebook screen.66 Cleaning CDs or DVDs.66 Protecting your computer from viruses.67 Updating Windows.70 Restoring your system.70
8 Troubleshooting. 71
Safety guidelines. First steps. Troubleshooting. Audio. Battery. CD drives. Device installation. Display. DVD drives. File management. Hard drive. Internet. Keyboard. Memory. Memory card reader. Modem (dial-up). Mouse. Networks. Passwords. PC Cards. Power. Printer. Sound. Status indicators. Video. Telephone support. Before calling Gateway Customer Care. Telephone numbers. 92 93
A Safety, Regulatory, and Legal Information. 95 Index. 107
@ptyrApw
Using the Gateway Web site Using Help and Support Using Your Computer guide Using online help
Chapter 1: Getting Help
Ssfyvqhsftyr ypgv
Xsfpxfipfyphpwwpyiphttyhstyr@fpfVpfppsf twwgpwpfpitsspfyityrfwtpwtfgtwtfyi pqxfyhpqypypgv8fhsfyipp@fpfypgv pspwfpphsywrfyifpsrsspxtyrpyfwt hywppypsffptipitsspgpih tgwp Xyp@fpfypgvtiptrypitipfyphptyfw gfwfyhpqpqxfyhpfyifgtwtXypgvpspwfp hstpfyixgtwphpphsywrtpxfyfrpsphpppi fyiphyxtyqfrpfpgfpwtqppptpyhpSstiptry tiptsxftxxpqxfyhpspywrrpity46p gfwfyhpitstxtpigfpwtqpspyygfpp Iwpfppfistxfyfwhfpqwwqfxtwtftppwqtsfyrp qpthpfyiVpsfpstrswtrspixpgfthhfpfyifqp tyqxftyspwvppypgvtyripftyr hyitty @fpffyigpstyifwpttyhxp tipgpqhwfpthpfyityfiittystrsfwt gfyiyfxphxypyffqqifgwpthpBqppsfpfgwpx vywpirpfgwpipithfpihxppthpipfxpytwwtip tsqfhytipfppthp Vptyhppwspsftwwphptpspxftqfhtyfyi pyuxpyqxyp@fpfypgvqpfhxp Ssfyvfrftyqxfwwqf@fpf
Gateway Web site
@fpfVpgtp
@fpfhywtyptfftwfgwp! spif$ ifpppv fyitipspxhpyitpihphtqthftytfw fyipyfwtpityqxftyfgypgvUttsp@fpf pRVpg tpfrfpfhx
TtyrpR
SsppRtptittipityqtpxfufpf'
RAxp IihR 7ywfi 6yfhT I6Sw
RAxp 6wthv Support Homespyhwthv All Support Documents fhhpih ihxpyftyphtqthftyfyirtipXhfyfwgpsrs sppqppyhpfpfwhfpfyfthwpphtqthspptysfp
6wthv Support Homespyhwthv General Tutorials fhhpfyppytp wtgfqsfthwpfyitipythhsfxfvtyrfit67 fyityfwwtyrfsfiitp
Battery charge indicator LCD panel release latch
Open the LCD panel by sliding the release latch.
Left side
Epqtip
Ventilation fan
USB ports IEEE 1394 port
Memory card reader
PC Card slot
Helps cool internal components. Caution: Do not block or insert objects into these slots. If these slots are blocked, your notebook may overheat resulting in unexpected shutdown or permanent damage to the notebook.
USB ports
Plug USB devices (such as a diskette drive, flash drive, printer, scanner, camera, keyboard, or mouse) into these ports. Plug an IEEE 1394 (also known as Firewire or i.Link) device (such as a digital camcorder) into this 4-pin IEEE 1394 port. Insert a memory card from a digital camera, MP3 player, PDA, or cellular telephone into the memory card reader. For more information, see Using the memory card reader on page 41. The memory card reader supports Memory Stick, Memory Stick Pro, MultiMediaCard, and Secure Digital. Insert one Type II PC Card into this slot. For more information, see Adding and removing a PC Card on page 43.
IEEE 1394 port
Qtrstip
Volume control Headphone jack
USB port
DVD/CD-RW or recordable DVD drive
Power connector
Microphone jack
Volume control Headphone jack Microphone jack USB port
Press forward to increase the volume. Press backward to decrease the volume. Press in to mute the volume.
Plug amplified speakers or headphones into this jack. The built-in speakers are turned off when speakers or headphones are plugged into this jack. Plug a microphone into this jack.
Plug USB (Universal Serial Bus) devices (such as a diskette drive, flash drive, printer, scanner, camera, keyboard, or mouse) into this port. Insert CDs or DVDs into this drive. For more information, see Using the DVD drive on page 38. This drive may be a combination DVD/CD-RW or recordable DVD drive. To determine the type of drive in the notebook, examine the drive trays plastic cover and compare the logo to those listed in Identifying drive types on page 38.
Back Component
Plug the AC adapter cable into this connector.
Ethernet jack Modem jack Monitor port
Kensington lock slot
Ethernet jack
Plug a 10/100 Ethernet network cable into this jack.
Modem jack
Plug a modem cable into this jack.
Monitor port Kensington lock slot
Plug an analog VGA monitor into this port. Secure your notebook to an object by connecting a Kensington cable lock to this slot.
Battery Battery latch
Battery lock
Memory bay
Hard drive bay
Battery Battery latch Hard drive bay Memory bay Battery lock
Provides power when the notebook is not plugged into AC power. Slide to release the battery. For more information, see Changing batteries on page 51. The hard drive is located in this bay. For more information, see Replacing the hard drive kit on page 60. Install as many as two memory modules into this bay. For more information, see Adding or replacing memory on page 57. Slide to unlock the battery. For more information, see Changing batteries on page 51.
Keyboard area
Dpgfifpf
Power button
Keyboard
Status indicators
Touchpad
Keyboard Status indicators Touchpad Power button
Provides all the features of a full-sized, 86-key keyboard. For more information, see Using the keyboard on page 29. Inform you when a drive is in use or when a button has been pressed that affects how the keyboard is used. For more information, see Status indicators on page 28. Provides all the functionality of a mouse. For more information, see Using the EZ Pad touchpad on page 33. Press to turn the power on or off. You can also configure the power button for Standby/Resume mode. For more information on configuring the power button mode, see Changing Power-saving Settings in Using Your Computer which has been included on your hard drive. To access this guide, click Start, All Programs, then click Gateway Documentation.
Bipytqtyrxipw
Important The labels shown in this section are for informational purposes only. Label information varies by model, features ordered, and location.
@fpfxipwfyiptfwyxgp
Sspwfgpwyspgxqypgvhyftytyqxftysf tipytqtpypgvxipwfyitqpfp@fpf6xp6fp twwyppisttyqxftytqhfwwqftfyhp
Website: Online Support: Tech Support Phone: Hours: Model: S/No: www.gateway.com www.gateway.com/support
Fthq6ptqthfpq4spytht
SspFthq6ptqthfpq4spythtwfgpwqyiyspgxq ypgvtyhwipspihvphipqpftyrpx
Finding your specifications
9tyityrphtqthfty
9xptyqxftyfgypgvhsfxpxtp xpxpfyisfiitptptt@fpf pRfrpf rfpfhxSsp pRfrpfwsfwtyvfiittyfw @fpfihxpyftyfyiipftwpiphtqthfty9xp tyqxftyppiTtyrpRwyfrp !
4hhptp
Sipfhhptpttsp4hhpRpffhhptprfpfhx
5fptp Bqyypgvygfppqppyipipti xffygfyfiittyfwgfphfyfgfptpspy yphpfRppi6sfyrtyrgfptpwyfrp "qxptyqxfty fgtyrfyfiittyfwgfp 6ftyrhfp @fpfsfwfrphffhthftyrhfptqyppifiittyfwfhp qfhhptpwtp Fpx Efrprfxhsfxwtxpitfrfxprfsthrfxpf wqxpxBqrfxfpyytyrxpwwsfystyv spswifiityrxpxpxRppi4iityrpwfhtyr xpxwyfrp "$qxptyqxfty Ityp XhfyffhsfwxfypqtypypgvSspx hxxypfptyvupfyiwfptypsthstytyhwgwfhv fyistp
Byvuptypfyihftirpfppwftpwtyppytpgspfp wpsfywfptypTtyrfytyvuphwtyphfyty thpgfyypfyirpptyrhfifpwwfihxpy Efptypfyihftirpfpxpppytpgsptyxhs qfpsfytyvuptypEfptypfpgppsfytyvuptyp spyfptytyrwfrpihxpy
TR5qwfsitp TpfTR5qwfsitpqtyrqtwpfyqptyrqtwpfysp hxp
@ptyrRfpi
Installing the battery Connecting the AC adapter Turning your notebook on and off Using the status indicators, keyboard, and the EZ Pad touchpad Adjusting the volume
Chapter 3: Getting Started
Byfwwtyrspgfp
To install the battery:
1 6wpspE67fypw 2 Syypgvpspgxtqfhtyr 3 Awispgfpwfgpwtipiyfyiwtipttysppygfp
wytwspgfphwthvtywfhp
4 Rwtipspgfpwhvspwhvpitty
Connecting the AC adapter
6yyphtyrsp46 fifp
Xhfyyypgvtyrfy46 fifpypgv gfpSspgfpfstpiftfwwhsfrpiXswi psp46 fifptrsffqwwhsfrpspgfp4wwspp sqspgfpqwwhsfrp
Important If the battery is not fully charged before you use your notebook on battery power for the first time, the battery life may be much shorter than you expect. If the battery life seems short even after being charged for three hours, the battery may need to be recalibrated. For information on recalibrating the battery, see Recalibrating the battery on page 49.
To connect the AC adapter:
1 6yyphspphisp46 fifp
Caution
Make sure that you use the AC adapter that came with your notebook or one of the same type purchased from Gateway. Replace the power cord if it becomes damaged. The replacement cord must be of the same type and voltage rating as the original cord or your notebook may be damaged.
2 6yyphsp46 fifpypgvphyyph
3 Iwrspphityffwwwp
SspgfphsfrptyithfyyppiSwyfrp qsp whftyqspgfphsfrptyithf Bqspgfphsfrptyithfipyyyhxwppsp qwwtyrpytwtyy'
a Tywrspfifpqxypgvspywrtgfhvty b Ip 9G9rrwpspfwtrsyfyiqq 4 Vspyqtytstyrypgvqspqttxpyqq
ypgvfyiwpfpypgvhyyphpi46 pytwsp gfphsfrptyithfyqq
Warning Do not attempt to disassemble the AC adapter. The AC adapter has no user-replaceable or user-serviceable parts inside. The AC adapter has dangerous voltages that can cause serious injury or death. Contact Gateway about returning defective AC adapters.
Important If the battery charge indicator does not turn off after three hours, contact Gateway Customer Care at support.gateway.com.
Iphtyrqxphpgwpx
7tyrfprpspwfrpwppwqpwphththxtyrty ypgvhfytyhpfpqffgpyxfwwppwfyihfpiffw pxifxfrpIphypgvfyiptspfwipthpg hyyphtyrspxf rp phsthsfggwfrprpfyi ppyspxqxpfhstyrypgv
Ttyrpftyrxip 4wffpvgpqptyrRfyigxipByRfyigxip ypgvpihpyqqsppxipthpphp xpxAppsptyqxftytyxpxtyfpispsfi itpBqpttyppisptyqxftytw
VspytyAtgpyfpxipypgvfpfwwxpxtyqxfty spsfiitpspyyspphxwppwqq
If your notebook is.
.and you want to.
Enter Standby mode Enter Hibernate mode (must be activated) Exit Standby or Hibernate mode
Click Start, then click Turn Off Computer. Press and hold RAB9S, then click Hibernate. Press the power button.
In Standby or Hibernate mode
TrfityrXGpgv
Adding and replacing memory Replacing the hard drive
Chapter 6: Upgrading Your Notebook
Ippytyrfthpwphtht ithsfrp
Important Before installing memory or replacing the hard drive, you should read and understand the information in this section.
Ssphxypytytipypgvfpppxpwpyttpfth pwphthtfwvyyf pwphfth ithsfrp8R7
Warning To avoid exposure to dangerous electrical voltages and moving parts, turn off your notebook and unplug the power cord, modem cable, and network cable before opening the case.
Warning
To prevent risk of electric shock, do not insert any object into the vent holes of the notebook.
5pqptyfwwtyrxpxpwfhtyrspsfiitpqwwspp rtipwtyp'
4tifthhftyrqfhphsfhfppiqwwfthfyi fhvtyrqfx Qpxphxypyqxsptfytfthgfrywspyfp pfipspx7ywfhxypyysptipq fytfthgfrgphfpywsptytipqspgfrtip pwphfthphty 4wfswihxypygsptpirp4tihstyrsppirp hyyphGppwtiphxypypfyqfhp Vpffryityrtffftwfgwpfxpwphythp fyiffhstfgfpxpfwfqvgpyhssp ryipihyyphty Shsfgfpxpfwqfhpyvgpyhsspryipi guph
Adding or replacing memory
4iityrpwfhtyrxpx
XypgvpxpxxiwphfwwpiRH7BFFRxfwwHwtyp 7fwBywtypFpxFiwpSspxiwpfpfftwfgwptyft hffhttpfyifyxiwphfygpwfhpityfyfftwfgwpwTpyw xpxxiwpiptrypiq@fpf ypgvqrfityr xpx
To add or replace memory modules:
1 9wwsprtipwtypyipiIppytyrfthpwphthtithsfrpw
yfrp "#
Syqqypgv 7thyyphsp46fifpxipxhfgwpfyiypvhfgwp 7thyyphfwwptspfwipthpfyipxpfyI6hfi Syypgvpspgxtqfhtyr Qpxpspgfp9xptyqxftyppi6sfyrtyrgfptpw yfrp " xpxgfppi5xwyfrp !
7 Qpxpspxpxgfhphp9spwhftyqsp
8 Rwtipspxpxgfhpspypxpt
9 Bqfppxtyrfxiwprpywpfiysphwtf
pfhspyiqspxpxxiwpytwspxiwptwfi
10 Iwwspxpxxiwpqspw
11 Awispyppwfhpxpyxiwpff iprppfyrwpfyip
ttysppxxpxwSstxiwptvppithfyyw gptyppityypitphtyBqspxiwpipyqtxfvpp sfspyhstyspxiwpwtyptsspfgtyspxpx gf
Important Use only memory modules designed for your Gateway notebook.
@pywsspxiwpiyytwthwthvtywfhp Qpwfhpspxpxgfhpspypwfhpsphphp Bypspgfpspyyypgvp 6yyphsppfifpxipxhfgwpfyiypvhfgwpspy yyypgv
Qpwfhtyrspsfiitpvt
Bqwiwtvpxpsfiitphffhthfypwfhptrtyfw itptsfstrsphffhtitp
To replace the hard drive kit:
1 5fhvfyifffyfyqpspypsfiitp9
xptyqxftyppi5fhvtyrqtwpwty Ttyr X 6xp sthssfgppytyhwipiysfiitpSfhhpstrtip hwthv Start All Programsspyhwthv Gateway Documentation yfrp "#
2 9wwsprtipwtypyipiIppytyrfthpwphthtithsfrpw 7
Syqqypgv 7thyyphsp46 fifpxipxhfgwpfyiypvhfgwp 7thyyphfwwptspfwipthpfyipxpfyI6hfi Syypgvpspgxtqfhtyr Qpxpspgfp9xptyqxftyppi6sfyrtyrgfptpw yfrp " hpspypxpt9spwhftyqspsfiitpgfhp ppi5xwyfrp !
8 Qpxpspsfiitpgfhphpwtipspsfiitpgf
Replacing the hard drive kit
9 Qpxpsphpphtyrspsfiitpvtspypgv
wtipspwisfiitpvtffqxspsfiitphyyphspy wtqspsfiitpvtqypgv
Screws
10 Bqypsfiitpfwpfityhwipspsfiitpvtgfhvp
rRp " HQ Bqyppixpspsfiitpvtgfhvpqxwisfi itpvtypsfiitprRp
11 Qpxpsphpsfphpspsfiitpspsfiitpvt
Qpxpspgfhvpqxspwiitp Bypspypitptyspgfhvpsphpswpwtyp Qpwfhpsphpsfphpspgfhvpspitp Rwtipspypsfiitpvttyypgvspypwfhpsp hpsfphpspsfiitpvtspypgv
16 Qpwfhpspsfiitpgfhpfyipwfhpsphphp 17 Bypspgfpspyyypgvp
18 6yyphsppfifpxipxhfgwpfyiypvhfgwpspy
yyypgv
19 9tyhtyytyfwwtyrVtyiitpfyi
fwthftyppsptyhtysfpptyhwipitssppp ith
Caring for your notebook Cleaning your notebook
FftyftytyrXGpgv
Protecting your notebook from viruses Updating Windows Restoring your system
Chapter 7: Maintaining Your Notebook
6ftyrqypgv
Sppyispwtqpqypgv'
5phfpqwygxiypgvfyiiyfy guphyqtSsphfpfwsrsyrtyxfip pfptrs Vspyfytyrypgvpphxxpyisft tyfhftyrhfp DppypgvffqxxfrypthqtpwiFfrypthqtpwihfy pfpiffysfiitp Gppyqqypgvspyspsfiitpwtrstygphfp iffyspsfiitphwigpwhpi 4tiguphtyrypgvppxppxpfphsfyrp SsphfpfyiE67fypwhfygphxpgtwpfyipfgpfvty hwipxpfpfyihfyxpwftystrspxpfp 7fxfrpipptspppxptyhppigffy4 frpypfwwpypgvtfqpfpxpfpsffp hxqfgwpq DppfwwwttiffqxypgvVspytwwpiy hxphxypyfwxfywttihfypwtyppxpw ppytppftsffpyhppiyipffy 4tiiitvpytyxpy7fyiithfyhwrsp typyfwxphsfytxfyihfywpfipxfypyifxfrpsp ypgv 7ygwhvsppytwftyqfywBqsppwfpgwhvpi ypgvxfpspfpwtyrtyypphpisiy pxfypyifxfrpspypgv Vspytyrypgvqfyppyipiptiqtxpywr 46 pfyipxpspgfpfqpithsfrtyrtff
Cleaning your notebook
6wpfytyrypgv
Dpptyrypgvhwpfyfyisppyqppqxispwvpp ypgvpqxtyrftgpXxffyrfspspptpx fyirpspfypgvhwpfytyrvt'
4qwtyqpphws 4yfpwhfyqftsfsffyffwtvpppyty 6yfg 47U7itphwpfytyrvt
6wpfytyrspppt
Warning When you shut down your notebook, the power turns off, but some electrical current still flows through your notebook. To avoid possible injury from electrical shock, unplug the power cord, modem cable, and network cable from the wall outlets.
4wfyqqypgvfyispptspfwgpqphwpfytyrfy hxypy4wpxpspgfpgpqphwpfytyrfyhxypy Tpfifxwtyqpphwshwpfyypgvfyispfq px7ypspswifgftpwpyhwpfypgphfp sphfyifxfrpspqtytsyhxypy Xypgvthwpigfththwfpisrssppyysphfp vppsppyqppqiVtsypgvypiqqfyi ywrrpigsspiffqxsppytsfifxhws5p hfpqwyitfyfptysppy7yfpxhwpfyi qxsptytipqypgv
6wpfytyrspvpgfi
Xswihwpfyspvpgfihhftyfwwgtyrfyfpwhfyq fttsfyffwtvpppytypxpifyiwtyfpi yipspvp Bqtwwwttiyspvpgfiyqqypgvfyiysp ypgvtipiyEpspwttiiftyspywpspvpgfii gpqptyrptfrftyBqspvpgfiipyvfqptitp xfyppipwfhp t
6wpfytyrspypgvhppy
ShwpfyfypgvE67hppypfqhwsfyifphwpfysp E67hppyRtfwtwpfpysphwsyppitphwysp hppyfyitpsphppytssphws
Caution A notebook LCD screen is made of specially coated glass and can be scratched or damaged by abrasive or ammonia-based glass cleaners.
6wpfytyr677U7
Vtpqxsphpypsppirpyfyityfhthwptyrfih xfippphtfwwqspp
Protecting your computer from viruses
Iphtyrhxpqx tp
4 ttfrfxsfffhsptpwqfqtwpyfhxpspy pfiqxyphxpfyspUtphfyifxfrpiffhfp hxpxfwqyhtyRxptpryipphpiqfpti qtxpgphfpspfpfhtfpiyfhpftyifp Iphhxpqxftg'
QprtptyrhqGy4ytUtfyightgtyrsp tipqtyttyifppthpXphptpifqppwtxtpitxp ghttyspGy4ytUtpthpspyhsfpi ypgv TtyrspGy4ytUtrfxhsphvqtwpfyirfx sffpffhspipxftwxpfrpiywfipiqxsp Bypyp 6sphvtyrfwwrfxqtpgpqptyfwwtyrspx 7tfgwtyrxfhythtFthqVifyi8hpwqtwp Sspprfxtwwfytqfihxpysffppytyr hyftyfxfhsfxtrssfpft IptithfwwiftyrspGy4ytUtrfxph frftyspwfptp FfvtyrpspVtyiRpht6pypthyqtrpitip tsspstrspwppwqphty
Tips & Tricks For more information about modifying security settings, see Modifying Security Settings in Using Your Computer which has been included on your hard drive. To access this guide, click Start, All Programs, then click Gateway Documentation.
Chapter 8: Troubleshooting
Rfqprtipwtyp
Vstwpgwpstyrypgvqwwsppfqprtipwtyp'
Gpppxpspxpxgfsfiitpgfhpstwp ypgvtypiystwpspgfpttyfwwpifyistwpsp xipxhfgwpypvhfgwpfyi46 pfifpfphyyphpi ypgv Ffvppsffphphwryipigpqpfhhptyrtypyfw hxypy9xptyqxftyfgppytyrifxfrpqx fthpwphthtppiIppytyrfthpwphthtithsfrpwy frp "# 4qphxwppfyxftypyfyhpfvspppxpsp xpxgfsfiitpgfhpxfvppsfpwfhpsp hpptyfwwfyhpspypwfhpspgfpgpqpf ypgv
Warning Do not try to troubleshoot your problem if power cords or plugs are damaged, if your notebook was dropped, or if the case was damaged. Instead, unplug your notebook and contact a qualified computer technician.
First steps
Bqsfpgwpxtsypgvsppstyrqt'
Ffvppsfsp46 pfifpthyyphpiypgv fyify46 wpfyisfsp46 wptwtyrp Bqpfptrpphxfvppsfttypi y Bqfptspfwipthphsffvpgfixpipyv xfvppsffwwhyyphtyfpphp Ffvppsfsfiitptyqww Bqfypxpfrpfpfysphppytpiysppfh xpfrpSspxpfrpxfspw@fpf6xp6fpty itfrytyrfyiqttyrspgwpx Bqfiipipxpiptspfwipthpptpsptyfwwfty hpippqxpifyixfvppsfqwwpipfhs tyhty Bqfyphhtyfrfxppsprfxtypi ihxpyftyspywtypspw
Help and Support For more information about troubleshooting, click Start, then click Help and Support. Type the keyword gwpstyr in the Search box , then click the arrow.
Sgwpstyrthfpwtpityfwsfgpthfwip
4itgwpstyrthppiyipiRyiwyfrp &
5fpgwpstyrthppiyipiIpwyfrp %%
67itpgwpstyrthppiyipi7U7itpwyfrp $#
7pthptyfwwfty
Xsfphxpgwpxfqpfiityrfypipthp RxptxpfypipthphsffI6 6fihfyhfpfpxphp BQPhyqwth6sphvBQPfrpippxtyptqspptfyBQPhyqwth
To check IRQ usage:
1 6wthv Startspyhwthv Control PanelSsp 6yw Ifypwtyi
pyBq6ywIfypwtty6fprUtphwthv Performance and Maintenance
Device ManagerSsp 7pthp Ffyfrptyipy
2 6wthv7gwphwthv Systemhwthvsp Hardwarefgspyhwthv 3 6wthv Viewspyhwthv Resources by type7gwphwthv Interrupt
itwfpi
request (IRQ)4wwBQPfyisptsfifpftryxpyfp
Troubleshooting
Help and Support For more information about IRQs, click Start, then click Help and Support. Type the keyword BQP in the Search box , then click the arrow.
To free IRQ resources for the new device:
1 Bysp 7pthp Ffyfrptyihsphvspipthpwtqf
phphyqwth4phphyqwthfpfffgwfhv phwfxftytytyfpwwhthwp
2 Qpxpspipthpfptyrtyfwwspyippxtyp
sthsypqsppttyripthphfyitfgwp
DisableSspipthptitfgwpi
3 Qtrshwthvspipthpfyitfgwpspyhwthv
Ssphppytifv 4iuspgtrsyptyrsppxvp9xptyqxftypp iRpxvphxgtyftywyfrp Ssphppypwtytyhph 6sfyrpsphppypwtyqxsp 7twf Iptpitfwrg
Sspppyfwvpgfiipyv Ffvppsfspvpgfihfgwptwrrpityhphw Qpxpfwwppytyhfgwpfyithsgp 6wpfyspvpgfigtyrfyfpwhfyqfttsfyf fwtvpppytypxpifyiwtyfpiyipspvp Sfvpgfisfvyvxfvppsfspvpgfi v Bqtwwpiwttityspvpgfiyqqypgvfyi ywrspvpgfi6wpfyspvpgfifyiyttipiy iftytEpspvpgfiigpqptyrtfrftyBqspvpgfi ipyvfqptitpxfyppipwfhpt
4vpgfihsffhpvppppftyrppfiDpgfihvw iDpqftwpwpxpfrp Ffvppsfystyrtptyryspvpgfi FfvppsffvptyhvIppfhsvpwpyfvpsf xtrsgphvspypfypgv Xfpptyrfwppvpfyifyxgpfpfysphppy SspyxpthvpfitypiyRppiRpxvphxgtyftyw yfrp qtyhtyyytyrqqyxpthvpfi
XppfiFpxpwxpfrp Ffvppsfspxpxxiwpfptyppihphwtysp xpxgfw9xptyqxftyppi4iityrpwfhtyr xpxwyfrp "$ Tpfstifitfrythrfxspwippxtyptqfxpx xiwptqftwtyr9xptyqxftyppi4iityrpwfhtyr xpxwyfrp "$ XppfiGpyrsxpxwpxpfrp 6wpfwwrfxspypfypgv
Help and Support For more information about troubleshooting memory errors, click Start, then click Help and Support. Type the keyword xpxp in the Search box , then click the arrow.
Fpxhfipfip
7tpwppqspxpxhfiwipyfpftyspF 6xptyi Qpgypgv
Fipxitfw
Xxipxipyitfwipyhyyph Ffvppsfspxipxhfgwptwrrpityspxipxufhv fyiysp8spypypvufhvRppi5fhvwyfrp xfvp psfsphyyphtysfpgppyxfiphphw Ffvppsfypgvthyyphpisppwpsypwtyp fyisppwpsypwtypsffitfwyp Ffvppsfspxipxhfgwptwpsfy# qpp% xppwyr Qpxpfywtypwtprpphqxpwpsyp wtypspyhsphvqfitfwypgwrrtyrfvtyrpwpsypty sppwpsypfwwufhv Bqsfpfiittyfwpwpsyppthphsfhfwwfttyrhfww xpfrtyrthpxftwxfvppsffwwxpfrpfphwpfpifyi hfwwfttyrtitfgwpigpqptyrspxipx6yfh pwpsyppthprpsphphhippxftwitfgwpsp pthp4wxfvppsfspxipxitfwtyrptpfpp ftfpw
To check the dialing properties:
pyBq6ywIfypwtty6fprUtphwthv Printers and Other Hardware
2 6wthv7gwphwthvspPhone and Modem Optionsthyspyhwthv
sp Dialing Rulesfg
3 6wthvspwhftyqxsthsfpitfwtyrspyhwthv Edit 4 Ffvppsffwwptyrfphph
For more information about dialing properties, click Start, then click Help and Support. Type the keyword itfwtyr in the Search box , then click the arrow.
7thyyphfyfyptyrxfhstypqfxfhstyptypsft yspfxpwtypfspxipx7yhyyphsppipthp spfxppwpsypwtypfspxipx FfvppsffpytyrfitrtfwwwpI5W wtyp Ssppwtypiyvtsxipx 6sphvqwtypytphfhshfhvwtyrtyryiEtyp ytptfhxxygwpxsfhfyhfpspxipxhyyph ffwpfpfgiywfippyithyyphSspqfpsp xipxspwpwtypytpthfywpfpfyitwwvhphw Etpyspwtyptyrpwpsyp7tfwftyrwpyxgphs f VspyspitfwypwtpyqwtypytpVtrrwpsp xipxhfgwppptqsfxfvpfitqqppyhpFfvppsfsp hyyphfpqppqxhtyfyifwwhptyspfww pwpsypfwwufhvfpphp Xhfyfwhfwwpwpsyppthpfyisfpsppwpsypwtyp hsphvpiqytpwwtypwppw
Sfysppwpsypwtypptspfitqqppypwpsypyxgpty spfpwpsypwtypffitqqppywhftyBqhfy hyyphystwtyphfwwpwpsyppthp ShyyphtyrtsspxipxffwphyyphtyppiBq pihtyrsphyyphppiwphyyphhfwwpwpsyp pthpSsppwpsypwtypxfgpyt
Help and Support For more information about network troubleshooting, click Start, then click Help and Support. Type the keyword ypvgwpstyr in the Search box , then click the arrow.
Xypgvipyfhhpfi Ffvppsf64IREH6DfyiGTFEH6Dfpypiqqspyppsp fi
Xqrffi Sspfiqpfpsthstptysp5BHRRptwttpphp tsypffphpfqrpyfiXxpy ypgvqpft6fww@fpf6xp6fpqtyhty
I6 6fi
XtyfwwpifI6 6fifyiyypgvtsftyrgwpx Ffvppsfsfphphwtyfwwpiptpiqfpqsp I6 6fi9xptyqxftyppI6 6fiihxpyfty FfvppsfspI6 6fityfwwpityhftyrfpx phphyqwth9xptyqxftyyphphyqwthpp i7pthptyfwwftywyfrp $!
Xypgvtyvtyry46 p Ffvppsf46 pfifpthyyphpihphw ypgv9xptyqxftyppi6yyphtyrsp46 fifpw yfrp Bqypgvtwrrpityfrpphxfvppsf sprpphthyyphpiphpwfypwphthfwwp ypiyfyivtyrhphwSpspwpwrfvtyr ipthphsffwfxtyspwpfyiyty Ffvppsfsp46 pfifphfgwpfpqppqxh ifxfrpQpwfhpfyifxfrpihfgwp Xypgvtyvtyrygfpp Ffvppsfspgfpttyfwwpihphw9xp tyqxftyppiByfwwtyrspgfpwyfrp Ffvppsfspgfptqwwphsfrpi9xptyqxfty ppiQphsfrtyrspgfpwyfrp !& Ffvppsfspgfpthfwtgfpihphw9xp tyqxftyppiQphfwtgftyrspgfpwyfrp !&
Ssptyptwwyyy FfvppsfsptyptywtypFfytypsfpfy ywtypqqwtypgysfxfyppip Ffvppsfspphfgwptwrrpityfy46 php Ssptyptygtwwyty 6sphvsphfgwpgpppysptypfyiypgvFfvpp sftthyyphpisphph FfvppsfsptyptywtypFfytypsfpfy ywtypqqwtypgysfxfyppipsptyphfy ftytyrIpspgysptypywtyp 6sphvspfyihfgwpqgpygvpyty Bqsptypfytytyspipqfwtypxfvp psfsfppwphpittysptypp
To set a default printer:
2 6wthv7gwphwthvspPrinters and FaxesthySspItypfyi
3 Qtrshwthvspyfxpqsptypfygpspipqfw
typspyhwthv Set as Default Printer
QptyfwwsptypitpRppsprtipsfhfxptstyp qtyhtyytyfwwtyrsptypitp
XppfiItyppptqwwwpxpfrp Ffvppsfsptyptypvqqwtyp
To make sure that the printer is not set to work offline:
3 QtrshwthvspyfxpqsptypfypBqspxpy
sfhsphvxfvypUse Printer OfflinehwthvUse Printer Offlinehwpfsphsphvxfv
For more information about printer troubleshooting, click Start, then click Help and Support. Type the keyword typgwpsp in the Search box , then click the arrow.
Vftytwqtwpsfpgppytypigpqppyityrfiittyfwqtwp sptyp Bqtywfrpqtwpxfyqtwpfyptxpxffy fiifiittyfwxpxsptypRppsptyp ihxpyftyqtyhtyqfiityrfiittyfwxpx
XppfiItyptqfpwpxpfrp 4qpfiityrfpxfvppsfsptyptywtypFtyp sfpfyywtypqqwtypgysfyppipfqpfiityrfp
Xfpyrptyryiqxspgtwtypfvp Ffvppsfspfisypfpywrrpityspspfisyp ufhv Ffvppsfspwxphywyypgvtypi 9xptyqxftyppiQtrstipwyfrp FfvppsfspVtyiwxphywtypi
FfvppsfFphywfpypiqq9xptyqxfty fgspxpptyrppiQtrstipwyfrp
Help and Support For more information about troubleshooting sound issues, click Start, then click Help and Support. Type the keyword yigwpsp in the Search box , then click the arrow.
Sspftyithffpyqyhtytyr FfvppspftyithffpypiyIp9G9rrwp sptyithf
Sspuphppyfwxyttyvtyr Ffvppsfsfpppi 9G9!fhtfpspppyfw xytty Ffvppsfspxyttypiyfyisfsptiphfgwp thyyphpihphw
Spwpsyp
5pqphfwwtyr@fpf6xp6fp
Bqsfpfphsythfwgwpxtsypgvqwwspp phxxpyiftygpqphyfhtyr@fpf6xp6fp'
Ffvppsfypgvthyyphpihphwfryipi 46 wpsftwtyrpBqpfrpphxfvp psfttypiy Bqfptspfwipthphsffvpgfixpipyfpf vxfvppsffwwhfgwpfpwrrpityphpw Bqsfpphpywtyfwwpisfifpqfpxfvppsf sfptyfwwpitfhhityrsptyhtytipitst Bqitiyhsfpspsfifpqfpqx@fpfpp spxfyqfhpihxpyftyfyiphsythfwphp Bqsfpiswptyfgtyrfrfxpp' HywtypApw Itypiihxpyfty SspFthqVtyiihxpyfty SspqfpgwtspVpgtp Rppspgwpstyrphtyqsthsfp
966iphwfftyqhyqxt
Qpytgwpf' @fpf6xfytpByh #@fpf7tpGsRt6tR7"$!& #" 9f'#" Iih' @fpf F @fpf !ptp SstipthphxwtptsIf "qsp966QwpHpftyqstihtguph spqwwtyrhyitty'stipthpxfyhfpsfxqwtypqppyhpfyi stipthpxfhhpfytypqppyhpphptpityhwityrtypqppyhpsfxfhfp yiptpipfty
Changes or modifications not expressly approved by Gateway could void the FCC compliance and negate your authority to operate the product.
6fwtqytfItty #"Vfytyr
Warning This product contains chemicals, including lead, known to the State of California to cause cancer, birth defects or reproductive harm.
FphVfytyr
The lamp in this display contains mercury. Do not put in trash. Recycle or dispose as hazardous waste.
SpwphxxythftypIf #%qsp6ipq9pipfwQprwfty69Q !$ fwthfgwpihqtpitsTR4xipx
XxipxhxwtptsIf #%qsp6ipq9pipfwQprwfty69Q !$wpHy sphxpxipxhfitfwfgpwsfhyftysp966prtftyyxgpfyi Qtyrp8tfwpyhpGxgpQ8GqstipthpBqpppisttyqxftyxgp tipisppwpsyphxfy 4pwpsypwtyphitsfxiwfwrtptpiqptsstipthpSspxipx tiptrypigphyyphpisppwpsypypvpxtpttyrtyrf hxftgwpxiwfufhvsthstIf #%hxwtfyRpptyfwwftytyhtyq ipftw SspQtyrp8tfwpyhpGxgpQ8Gtpiippxtypspyxgpqipthpsths xfgphyyphpisppwpsypwtyp8hptpQ8Gyfpwpsypwtypxfpwty spipthpytyrtyrtypypfytyhxtyrhfwwByxfpfspxqQ8G swiyphppiqtp"Sgphpftyqspyxgpqipthpsfxfgphyyphpi fwtypfippxtypigspfwQ8Ghyfhspwhfwpwpsyphxfy Bqstipthphfpsfxsppwpsypypvsppwpsyphxfytwwytq tyfifyhpsfpxfithytyfyhpqpthpxfgpptpiSsppwpsyp hxfyxfppsfithyyphspptxpyytwspgwpxtpwpi Ssppwpsyphxfyxfxfvphsfyrptytqfhtwttpptxpypfty hpipsfhwifqqphsppftyqstptxpyBqstsfpysp pwpsyphxfytwwtipfifyhpythptyipqxfvpyphpf xitqthftyxftyftyytyppipthp Sstptxpyhfyygppiypwpsyphxfytipihtypthp6yyphty fwtyppthptguphfpftqq6yfhspfpgwthtwthxxtty gwthpthphxxttyqtyqxfty Vspyrfxxtyrxfvtyrphfwwpxprpyhyxgp' Qpxftyyspwtypfyigtpqwpwftyspitfhspsppfyqsphfww Ipqxhsfhtttptyspqqpfvshsfpfwxytyrwfpppytyr SspTytpiRfpSpwpsyp6yxpIphty4hq&&xfvptywfqwqfy pypfhxpsppwphythipthppyifyxpfrptffpwpsyp qfxfhstypywphsxpfrphwpfwhyftytyfxfrtyfspgxqpfhs fyxtpifrpyspqtfrpqspfyxttyspifpfyitxpttpyfy tipytqthftyqspgtypsppytsptyittifwpyityrspxpfrpfyi
sppwpsypyxgpqsppyityrxfhstyphsgtypsppyt tyittifwQpqpqfhxxythftyqfpihxpyftyqipftwys hxwtsspqfgfyityrptpxpy
6fyfif
Byi6fyfifB6BypytyfwpxtppQRR
EpQfitfyxtppipthpfitqppyhQ9tpwphxxythfty ipthppftyrtysp! @Agfyifyi"" o " " @Agfyixfgpppy pxgpiipityypgvpxSstphtytywfwthfgwptqsppipthpfp ppyQpqpsppxwfgpwptqspppyhpqtpwpipthp Vtpwpipthpsfxfgptypxfpywfwtqtpiqpty6fyfiftqfy Byi6fyfifB7yxgptysppxwfgpw 4frpypfwrtipwtypfpfftyq hx% tyhspgpppysptpwpipthpfyisp giqpqftpwpipthpypfspgistipytyhwipppxttpt thfwSstipthpswigppixpsfy hx% tyhspqxspgispy tpwpipthpfpySsppqsptpwpipthpipthpsthsxfgp pxgpiipityypgvtpwwgpwspQ9 ppwtxtfpgByi 6fyfif Hpftyqstipthptguphspqwwtyrhyitty'Sstipthpxfy hfpsfxqwtypqppyhpfyistipthpxfhhpfytypqppyhpphptpi tyhwityrtypqppyhpsfxfhfpyiptpipftyqspipthp
Caution To prevent radio interference to licensed service or co-channel Mobile Satellite systems, this device is intended to be operated indoors and away from windows to provide maximum shielding. Equipment (or its transmit antenna) that is installed outdoors is subject to licensing.
Wireless devices are not user-serviceable. Do not modify them in any way. Modification to a wireless device will void the authorization to use it. Contact Gateway for service.
The transmitting device embedded in this system may not be used with any antenna other than provide with the system.
Caution The 802.11A radio LAN your system may have been equipped with operates in the same frequency range as high power radar, which has priority use, and may damage the radio LAN if both are present and being used in the same area.
TytypytyfwpxtppB68R
Sstitrtfwfffipyphppisp6wf 5wtxtqfitytppxttyqx itrtfwffffptyspfittypqppyhpprwftyqByi6fyfif Eppyffptwyxtpyxpfipgtfitwphtpiffywpwtxtp fwthfgwpfffptwyxtpip6wfp 5phtpifywprwpxpywp gtwwfrpfitwphtpithfByitp6fyfif SspByi6fyfifwfgpwtipytqtphptqtpiptxpySsthptqthftyxpfysfsp ptxpyxpphpftypwphxxythftyypvphtppftyfyifqp ptpxpySsp7pfxpyipyrffyppspptxpytwwpfpspp ftqfhty 5pqptyfwwtyrstptxpypswixfvppsfttpxttgwpgp hyyphpispqfhtwttpqspwhfwpwphxxythftyhxfySspptxpyx fwgptyfwwpityrfyfhhpfgwpxpsiqhyyphtyByxphfpsptytip ttyrfhtfpitsftyrwpwtyptyittifwpthpxfgpppyipigxpfyqf hptqtpihyyphfpxgwSsphxpswigpffpsfhxwtfyhptssp fgphyittyxfyppyiprfiftyqpthptyxptfty Qpfthptqtpiptxpyswigpxfipgfyfstpi6fyfitfyxftypyfyhp qfhtwtiptryfpigspwtp4ypftfwpftyxfipgsppst ptxpyptxpyxfwqyhtyxfrtpsppwphxxythftyhxfyhfp ppsppithyyphspptxpy Tpswixfvppqsptyphtysfsppwphthfwryihyyphtyq spptwtpwpsypwtypfyitypyfwxpfwwthfptppxtqppyfp hyyphpirpspSstphftyxfgpfthwfwtxfytyfwfpf
Warning To avoid electrical shock or equipment malfunction do not attempt to make electrical ground connections by yourself. Contact the appropriate inspection authority or an electrician, as appropriate.
SpwphxxythftypByi6fyfif6R qihqtpitsfy B6hxwtfyxipx
SspQtyrp8tfwpyhpGxgpQ8Gftrypipfhspxtyfwipthptipfy tyithftyqspxftxxyxgpqpxtyfwfwwpigphyyphpifpwpsyp typqfhpSsppxtyftyyfytypqfhpxfhytqfyhxgtyftyqipthp guphywspptpxpysfspxqspQtyrp8tfwpyhpGxgpqfwwsp ipthpipyphppi "
Efpfqpfpxpy
Tags
Quicktime 7 UC8T2 Drive Express Battery HQ6070 Omni 2000 Samsung C260 Kettler EXT7 DTB-9401V AVL 109 LG-R64 Frontman 15B ROC3205 100-A Keyboard B2700 Adsl2MUE Witxl 129 ICR-350 MG15CDR Pioneer A-C3 Dampfsterilisator Ftxr28EV1B9 WD-11401TB DVH940 PNA 3215 Tpmc-8X Bahamas MP46 SVI43BF1 FX140-2002 Magicolor 2530 RVD-6090 DR-BT21G Manual Edifier R351 Convertible 2003 ML500 Perception 420 Poulan 2050 PI 3630 17432 Wireless Driver Light Cndv-80MT M3100 MDS-S9 Scanmaker 6800 TT 6143 Artista 640E TA-F501ES GT-S7350 XS350-XS250 68-35 R-15 R-30 320 GB AVR-2308 DB348RMP VA-aceplus KD-R303 LE37S61B DMC-LC20 PV-S460 Lego 4496 S12ACP CS5111-2 BV9600 SGH-M628 WD-1021WF Service Manual SC-EH600 LE32A577p2M Fostex 3050 Nokia PD-1 PSR-640 MP250 76 C GA-8VM800M LBE 129 Explorer-1998 Motokrzr K3 Csue9JKE ANT24-2100 XL800-2001 Bios Update KS-FX433R HP-237 IS 2000 Laptop LC-22SV2E CDP-CX57 4 0 2494HM KDC-W5041U STR-DA2000ES RQ-SX72 Sony A200 C-500 Zoom AM-619 TH-50PHD3 Qtouch 2 30PF9946-12 97110 VSX-AX4asi-S Nokia 5300 Psae6 EL-6053 6810
manuel d'instructions, Guide de l'utilisateur | Manual de instrucciones, Instrucciones de uso | Bedienungsanleitung, Bedienungsanleitung | Manual de Instruções, guia do usuário | инструкция | návod na použitie, Užívateľská príručka, návod k použití | bruksanvisningen | instrukcja, podręcznik użytkownika | kullanım kılavuzu, Kullanım | kézikönyv, használati útmutató | manuale di istruzioni, istruzioni d'uso | handleiding, gebruikershandleiding
Sitemap
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101








1. NEW Laptop/Notebook AC Adapter/Battery Charger Power Supply Cord for Gateway m 6333 T 1600 M320 M270 MT3707 MX3225 M 6307 M 6308 MT6730 MT6916 MT6917b T 1622 T 1625 M 6816 M 6816M M 6750 M 6752 M305CRV MT6707
2. 175 Watt Power Inverter Car Adapter for the Gateway PA 1650 01, M320, Solo 400 Series, Solo 450, Solo 600, and W322, (by Wasabi Power )
3. NEW Laptop/Notebook AC Adapter/Battery Charger Power Supply Cord for Gateway 2522772R m 6335 MA1 MA2 MA2A MA3 MA7 ml MX6214 M320 MX3215 MX6955 M210 M225 M250 M325 MT3421 MT3422 MT3423 MT6821
4. NEW AC Adapter Power Supply Charger+Cord for Gateway 4025GZ MX8721M M250 M275 M305CRV M320 M460 M465 MA3 MA7 MT6705 MX6956 ma1 ma2 ma2a
5. Techno Earth NEW Laptop/Notebook AC Adapter/Battery Charger Power Supply Cord for Gateway M320 M270 MT3707 MX3225 M 6307 M 6308 MT6730 MT6916 MT6917b T 1622 T 1625 M 6816 M 6816M M 6750 M 6752 M305CRV MT6707
6. 2 new
